KEGG   Aminobacter sp. MSH1: CO731_00886Help
Entry
CO731_00886       CDS       T05420                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00260  Glycine, serine and threonine metabolism
amih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01130  Biosynthesis of antibiotics
amih01230  Biosynthesis of amino acids
Module
amih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CO731_00886 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CO731_00886 (trpB)
Enzymes [BR:amih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CO731_00886 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AWC21435
UniProt: A0A2S0XEE4
Position
908045..909265
Genome map
AA seq 406 aa AA seqDB search
MNKPTEPNSFRTGPDEQGMFGIFGGRFVAETLMPLILELQRHWDEAKNDPAFKAELNDLS
THYAGRPSKLYYAEGLTRHLGGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGFPCFVYMGATDVERQKPNVFRMKLLGAEVRPVNAGHGTLKD
AMNEALRDWVTNVHDTYYLIGTAAGPHPYPELVRDFQSVIGTEARTQILEQEGRLPDVIV
AAVGGGSNAIGLFHPFLDDRSVKIVGIEAGGRGLDGIEHCASMNAGSPGVLHGNRTYLLQ
NADGQILDGHSISAGLDYPGVGPEHSWLRDTGRVEYVPILDDEALDAFQLTTKVEGIIPA
LESAHAIAHAVKVAPTMGKDKVMIVNLSGRGDKDVHTVAQMLGMEI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagccgactgagcccaattctttccgtaccggacccgacgagcagggcatgttc
ggcattttcggcggacggttcgttgccgaaacgctgatgccgctgatcctcgaactgcag
cgtcactgggacgaggccaagaacgatccggccttcaaggcggagctgaacgacctgtcg
acccattatgccgggcggccctccaagctctattatgccgaaggcctgacccggcatttg
ggcggcgcgaagatctacttcaagcgcgaagacctcaaccacaccggctcgcacaagatc
aacaattgcctcggccagatcctgcttgccaagcgcatgggcaagacccgcatcatcgcc
gaaaccggcgccggccagcatggcgtcgcatcggcgacggtcgctgcccgcttcggcttc
ccgtgcttcgtctacatgggcgccaccgacgtcgagcggcagaagcccaacgtcttccgg
atgaagctgctcggtgccgaggttcggcccgtcaacgccgggcacggcacgctcaaggac
gccatgaacgaggcgctgcgtgactgggtcaccaacgtgcacgacacctattacctgatc
ggcacggccgccggcccgcacccctatccggaactggtccgcgacttccagtcggtgatc
ggcaccgaggcgcgcacccagatcctcgaacaggaagggcgcctgcccgacgtgatcgtg
gccgccgtcggcggcggctcgaatgcgattggcctgttccaccccttccttgacgaccgc
agcgtcaagatcgtcggcatcgaagccggcggccgcgggctcgacggcatcgagcactgt
gcctcgatgaatgccggcagccccggcgtgctgcacggcaaccgcacctatctgttgcag
aacgccgacggccagatcctcgacggtcattcgatctcggcaggcctcgactaccccggc
gtcggccccgaacatagctggctgcgcgacaccggccgcgtcgaatacgtgccgatcctc
gacgacgaggcgctggacgcgttccagctcaccaccaaggtggaaggcatcatcccggcg
ctggaatcggcccatgccatcgcgcatgccgtcaaggtcgcgccgaccatgggcaaggac
aaggtgatgatcgtcaacctgtcgggccgcggcgacaaggacgtgcatacggtcgcacaa
atgctgggcatggagatctga

KEGG   Aminobacter sp. MSH1: CO731_00887Help
Entry
CO731_00887       CDS       T05420                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00260  Glycine, serine and threonine metabolism
amih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01130  Biosynthesis of antibiotics
amih01230  Biosynthesis of amino acids
Module
amih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CO731_00887 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CO731_00887 (trpA)
Enzymes [BR:amih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CO731_00887 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF561 Staph_haemo Fiji_64_capsid
Motif
Other DBs
NCBI-ProteinID: AWC21436
UniProt: A0A2S0XEE6
Position
909268..910107
Genome map
AA seq 279 aa AA seqDB search
MTTRIDRRMAKLKAEGRPALVTYFMGGDPDYETSLSIMRALPKAGSDIIELGMPFSDPMA
DGPAIQAAGLRALKAGQTLGKTLQMAREFRKDDNETPIVMMGYYNPIYIYGVDRFLEDAI
ASGIDGLIVVDLPPEMDAELCIPALKAGINFIRLATPTTDDKRLPKVLENTSGFVYYVSM
TGITGSALADTSKVAEAVKRIKAHTDLPVCVGFGVKTAEQAKTIGASADGVVVGTAIVNA
VANVIGPKGEKTADPAEAVATLVNGLSQGIRAARLATAQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgcatcgaccgccgcatggcgaagctcaaggccgaaggccgtcccgcgctg
gtgacctatttcatgggcggcgaccccgactacgagacatcgttgtcgatcatgagggcg
ctgcccaaggccggcagcgacatcatcgagcttggcatgccgttttccgacccgatggcc
gacggcccggcgatccaggccgccggcctgcgcgcgctgaaggccggccagacgctgggc
aagacgcttcagatggcgcgcgagttccgcaaggacgacaacgagacgccgatcgtcatg
atgggctactacaacccgatctacatctatggtgtcgaccgctttctcgaggatgcaatc
gcctccggcatcgacgggctgatcgtcgttgacctgccgccggagatggatgccgaactg
tgcatccccgcactcaaggccggcatcaacttcatccgcctggcgaccccgacgaccgac
gacaagcgcctgcccaaggtgctcgagaacacgtccggcttcgtctactacgtgtcgatg
accggcatcaccggttcggcgctggccgacacgagcaaggtggccgaagcggtgaagcgc
atcaaggcccataccgacctgccggtctgcgtcggcttcggcgtcaagaccgccgagcag
gcgaagaccatcggcgcatcggccgacggcgtggtcgtcggtaccgcgatcgtcaatgcg
gttgccaatgtcatcgggccgaagggcgagaaaaccgccgatccggccgaggctgtcgca
acgctggtcaacggcttgtcccagggcattcgtgctgcacgccttgctaccgcccaataa

DBGET integrated database retrieval system