KEGG   Aminobacter sp. MSH1: CO731_01075Help
Entry
CO731_01075       CDS       T05420                                 

Gene name
acnA_1
Definition
(GenBank) Aconitate hydratase 1
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00020  Citrate cycle (TCA cycle)
amih00630  Glyoxylate and dicarboxylate metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
amih01210  2-Oxocarboxylic acid metabolism
amih01230  Biosynthesis of amino acids
Module
amih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amih_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
amih_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CO731_01075 (acnA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    CO731_01075 (acnA_1)
Enzymes [BR:amih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     CO731_01075 (acnA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AWC21623
UniProt: A0A2S0XEY6
Position
1097122..1099812
Genome map
AA seq 896 aa AA seqDB search
MSKSLDSFNCRRTLTAAGTDYVYYSLIEAEKNGLTGISQLPYSMKVLLENLLRNEDGRTV
TKEAIQAVAGWLTDKGTAGVEIAYRPARVLMQDFTGVPAVVDLAAMRDGLASLSGDPQKI
NPLVPVDLVIDHSVIVDEFGTPLAFARNVELEYERNEERYKFLKWGQQAFRNFRVVPPGT
GICHQVNLEYLAQTVWTNTEDGETTAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAM
LGQPVSMLLPEVIGFRLTGKLKEGVTATDLVLTVTQMLRKKGVVGKFVEFFGPGLSNMTL
ADRATIGNMAPEYGATCGFFPVDAETIRYLNMSGRAENRIALVEEYSKAQGMWRDASSAD
PVFTDLLELDLETVVPSMAGPKRPEGRIPLEGIAAGFATALEAEYKKTVDQSKRYAVEGE
SFDLGHGDVVIAAITSCTNTSNPSVLIGAGLLARNANRLGLKQKPWVKTSLAPGSQVVAE
YLEKAGLQKELDQIGFNLVGFGCTTCIGNSGPLPAPISKTINDKGLIGAAVLSGNRNFEG
RVSPDVQANYLASPPLVVAYALAGSVTKDLTTEPLGEDRDGKPVFLRDIWPTNVEIDRFI
AENVTRELFARKYADVFKGDENWQNVQAPEGQTYAWDDQSTYVQNPPYFVGMGARPGAIG
KIEGARVLGLFGDKITTDHISPAGSIKAASPAGKYLTDNGVGVADFNQYGTRRGNHEVMM
RGTFANIRIRNHMLGENGREGGYTFHYPSKEEMPIYDAAMQYRSEGTPLVIFAGVEYGNG
SSRDWAAKGTNLLGVRAVIAQSFERIHRSNLVGMGVIPFTFEDGTSWKTLGLKGDEQVTI
EGLETIKPRQKMVAKVTFADGSTKDVPILCRIDTLDELDYFKNGGILQYVLRDLAA
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaatcactcgacagtttcaattgccgccgcacgctgactgctgctggcaccgac
tatgtctattacagcctgatcgaggccgaaaagaacggcctgaccggcatctcgcagctg
ccctattcgatgaaggtgctgctggaaaacctgttgcgcaacgaagacggccgcaccgtc
accaaggaggcgatccaggcggtcgccggctggctgaccgacaagggcaccgccggtgtc
gagatcgcctaccgcccggcgcgtgtgctgatgcaggacttcaccggcgtccccgccgtc
gtcgacctcgccgccatgcgtgacggcctcgcctcgctcagcggcgatccgcagaagatc
aacccgctggtgccggtcgatctggtcatcgaccactcggtgatcgtcgacgaattcggc
acgccgctggcgttcgcccgcaacgttgagctcgaatacgagcgcaacgaagagcgctac
aagttcctgaagtggggccagcaggcgttccgcaacttccgcgtcgtgccgcccggcacc
ggcatctgccaccaggtcaacctcgaatacctcgcccagacggtgtggaccaacaccgag
gacggcgaaaccaccgcttatcccgacacctgcgtcggcaccgattcgcacaccaccatg
gtcaacggccttggcgtgctcggctggggggtcggcggcatcgaggcggaagcggcgatg
ctcggccagccggtgtcgatgctgctgcccgaggtcatcggcttccgcctgaccggcaag
ctgaaggagggcgtcaccgccaccgacctggtgctgaccgtcacccagatgctgcgcaag
aagggcgtcgtcggcaagttcgtcgagttcttcggcccgggcctgtccaacatgacgctg
gccgaccgtgccaccatcggcaacatggcgcccgaatatggcgcgacctgcggcttcttc
ccggtcgatgccgagaccatccgctacctcaacatgtcgggccgcgccgaaaaccgcatc
gcactggtcgaggaatattccaaggcgcaaggcatgtggcgcgacgcctcgtcggccgat
cccgtcttcaccgacctgctcgagctcgatctcgaaaccgtcgtgccgtcgatggccggc
ccgaagcgccccgagggccgcatcccgctcgaaggcatcgccgcgggctttgcgaccgcg
ctcgaagccgaatacaagaagaccgtcgaccagtcgaagcgttacgccgtcgagggcgaa
agcttcgacctcggccatggcgacgtggtgatcgcggcgatcacgtcgtgcaccaacacc
tcgaacccgagcgtgctgatcggtgccgggctgctcgcccgcaacgccaaccgcctcggc
ctcaagcagaagccgtgggtcaagacctcgctggcgccgggttcgcaggtggtggccgaa
tatctcgagaaggccggcctgcagaaggagctcgaccagatcggcttcaacctcgtcggc
ttcggctgcaccacctgcatcggcaactccggaccgctgccggccccgatctccaagacc
atcaacgacaagggcctgatcggtgcggcggtgctttcgggcaaccgcaacttcgaaggc
cgcgtctcgcccgacgtgcaggccaactacctggcctcgccgccgctggtggtcgcctat
gcgcttgccggttcggtgaccaaggacctgaccacagagccgctcggcgaggaccgcgac
ggcaagccggtgttcctgagggatatctggccgaccaatgtcgagatcgaccggttcatc
gccgaaaacgtcacccgcgagctgtttgcgcgcaaatatgccgacgtcttcaagggcgac
gagaactggcagaacgtccaggcgccggaaggccagacctatgcctgggacgaccagtcg
acctatgtgcagaacccgccctacttcgtcggcatgggcgcgcgcccgggtgcgatcggc
aagatcgagggcgcacgcgtgctcggcctgttcggcgacaagatcaccaccgaccacatc
tcgccggccggttcgatcaaggcggcctcgcctgccggcaagtacctgaccgacaatggc
gtcggcgtcgccgacttcaaccagtacggcacgcgtcgtggcaaccacgaggtgatgatg
cgcggcaccttcgccaacatccgcatccgcaaccacatgctcggcgagaacggccgcgag
ggcggctacaccttccactatccgtccaaggaagagatgccgatctacgatgcggcgatg
cagtaccgcagcgaaggcacaccgctggtgatcttcgccggcgtcgaatacggcaacggc
tcgtcgcgcgactgggcggccaagggcaccaacctgctcggcgtgcgcgcggtcatcgcc
cagagcttcgagcgcatccaccgctccaacctggtcggcatgggcgtcatcccgttcacc
ttcgaggacggcacgagctggaagacgctcggcctcaagggcgacgaacaggtgacgatc
gagggcctggagacgatcaagccgcgccagaagatggtcgccaaggtcaccttcgccgac
ggctcgaccaaggacgtgccgatcctgtgccgcatcgatacgctcgacgaactcgactac
ttcaaaaacggcggcatcctgcaatacgtcctgcgtgacctcgccgcgtaa

KEGG   Aminobacter sp. MSH1: CO731_01862Help
Entry
CO731_01862       CDS       T05420                                 

Gene name
acnA_2
Definition
(GenBank) Aconitate hydratase 1
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00020  Citrate cycle (TCA cycle)
amih00630  Glyoxylate and dicarboxylate metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
amih01210  2-Oxocarboxylic acid metabolism
amih01230  Biosynthesis of amino acids
Module
amih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amih_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
amih_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CO731_01862 (acnA_2)
   00630 Glyoxylate and dicarboxylate metabolism
    CO731_01862 (acnA_2)
Enzymes [BR:amih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     CO731_01862 (acnA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AWC22404
UniProt: A0A2S0XH59
Position
1847003..1849690
Genome map
AA seq 895 aa AA seqDB search
MSKSLDSFNCRRTLTAAGTDYVYYSLIEAEKNGLTGISQLPYSMKVLLENLLRNEDGRTV
TKEAIQAVAGWLTDKGTAGVEIAYRPARVLMQDFTGVPAVVDLAAMRDGLASLSGDPQKI
NPLVPVDLVIDHSVIVDEFGTPLAFARNVELEYERNEERYKFLKWGQQAFRNFRVVPPGT
GICHQVNLEYLAQTVWTNTEDGETTAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAM
LGQPVSMLLPEVIGFRLTGKLKEGVTATDLVLTVTQMLRKKGVVGKFVEFFGPGLSNMTL
ADRATIGNMAPEYGATCGFFPVDAETIRYLNMSGRAENRIALVEEYSKAQGMWRDASSAD
PVFTDLLELDLETVVPSMAGPKRPEGRIPLEGIAAGFATALEAEYKKTVDQSKRYAVEGE
SFDLGHGDVVIAAITSCTNTSNPSVLIGAGLLARNANRLGLKQKPWVKTSLAPGSQVVAE
YLEKAGLQKELDQIGFNLVGFGCTTCIGNSGPLPAPISKTINDKGLIGAAVLSGNRNFEG
RVSPDVQANYLASPPLVVAYALAGSVTKDLTTEPLGEDRDGKPVFLRDIWPTNVEIDRFI
AENVTRELFARKYADVFKGDENWQNVQAPEGQTYAWDDQSTYVQNPPYFVGMGARPGAIG
KIEGARVLGLFGDKITTDHISPAGSIKAASPAGKYLTDNGVGVADFNQYGTRRGNHEVMM
RGTFANIRIRNHMLGENGREGGYTFHYPSKEEMPIYDAAMQYRSEGTPLVIFAGVEYGNG
SSRDWAAKGTNLLGVRAVIAQSFERIHRSNLVGMGVIPFTFEDGTSWKTLGLKGDEQVTI
EGLETIKPRQKMVAKVTFADGSTKDVPILCRIDTLDELDYFKNGGILQYVLRDLA
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaatcactcgacagtttcaattgccgccgcacgctgactgctgctggcaccgac
tatgtctattacagcctgatcgaggccgaaaagaacggcctgaccggcatctcgcagctg
ccctattcgatgaaggtgctgctggaaaacctgttgcgcaacgaagacggccgcaccgtc
accaaggaggcgatccaggcggtcgccggctggctgaccgacaagggcaccgccggtgtc
gagatcgcctaccgcccggcgcgtgtgctgatgcaggacttcaccggcgtccccgccgtc
gtcgacctcgccgccatgcgtgacggcctcgcctcgctcagcggcgatccgcagaagatc
aacccgctggtgccggtcgatctggtcatcgaccactcggtgatcgtcgacgaattcggc
acgccgctggcgttcgcccgcaacgttgagctcgaatacgagcgcaacgaagagcgctac
aagttcctgaagtggggccagcaggcgttccgcaacttccgcgtcgtgccgcccggcacc
ggcatctgccaccaggtcaacctcgaatacctcgcccagacggtgtggaccaacaccgag
gacggcgaaaccaccgcttatcccgacacctgcgtcggcaccgattcgcacaccaccatg
gtcaacggccttggcgtgctcggctggggggtcggcggcatcgaggcggaagcggcgatg
ctcggccagccggtgtcgatgctgctgcccgaggtcatcggcttccgcctgaccggcaag
ctgaaggagggcgtcaccgccaccgacctggtgctgaccgtcacccagatgctgcgcaag
aagggcgtcgtcggcaagttcgtcgagttcttcggcccgggcctgtccaacatgacgctg
gccgaccgtgccaccatcggcaacatggcgcccgaatatggcgcgacctgcggcttcttc
ccggtcgatgccgagaccatccgctacctcaacatgtcgggccgcgccgaaaaccgcatc
gcactggtcgaggaatattccaaggcgcaaggcatgtggcgcgacgcctcgtcggccgat
cccgtcttcaccgacctgctcgagctcgatctcgaaaccgtcgtgccgtcgatggccggc
ccgaagcgccccgagggccgcatcccgctcgaaggcatcgccgcgggctttgcgaccgcg
ctcgaagccgaatacaagaagaccgtcgaccagtcgaagcgttacgccgtcgagggcgaa
agcttcgacctcggccatggcgacgtggtgatcgcggcgatcacgtcgtgcaccaacacc
tcgaacccgagcgtgctgatcggtgccgggctgctcgcccgcaacgccaaccgcctcggc
ctcaagcagaagccgtgggtcaagacctcgctggcgccgggttcgcaggtggtggccgaa
tatctcgagaaggccggcctgcagaaggagctcgaccagatcggcttcaacctcgtcggc
ttcggctgcaccacctgcatcggcaactccggaccgctgccggccccgatctccaagacc
atcaacgacaagggcctgatcggtgcggcggtgctttcgggcaaccgcaacttcgaaggc
cgcgtctcgcccgacgtgcaggccaactacctggcctcgccgccgctggtggtcgcctat
gcgcttgccggttcggtgaccaaggacctgaccacagagccgctcggcgaggaccgcgac
ggcaagccggtgttcctgagggatatctggccgaccaatgtcgagatcgaccggttcatc
gccgaaaacgtcacccgcgagctgtttgcgcgcaaatatgccgacgtcttcaagggcgac
gagaactggcagaacgtccaggcgccggaaggccagacctatgcctgggacgaccagtcg
acctatgtgcagaacccgccctacttcgtcggcatgggcgcgcgcccgggtgcgatcggc
aagatcgagggcgcacgcgtgctcggcctgttcggcgacaagatcaccaccgaccacatc
tcgccggccggttcgatcaaggcggcctcgcccgccggcaagtacctgaccgacaatggc
gtcggcgtcgccgacttcaaccagtacggcacgcgccgcggcaaccatgaggtgatgatg
cgcggcaccttcgccaacatccgcatccgcaaccacatgctgggcgagaacggccgcgag
ggcggctacaccttccactacccgtcgaaggaagagatgccgatctacgatgcggcgatg
cagtaccgcagcgaaggcacaccgctggtgatcttcgccggcgtcgaatacggcaacggc
tcgtcgcgcgactgggcggccaagggcaccaacctgctcggcgtgcgcgcggtcatcgcc
cagagcttcgagcgcatccaccgctccaacctggtcggcatgggcgtcatcccgttcacc
ttcgaggacggcacgagctggaagacgctcggcctcaagggcgacgaacaggtgacgatc
gagggcctggagacgatcaagccgcgccagaagatggtcgccaaggtcaccttcgccgac
ggctcgaccaaggacgtgccgatcctgtgccgcatcgatacgctcgacgaactcgactac
ttcaaaaacggcggcatcctgcaatacgtcctgcgtgacctcgcgtag

DBGET integrated database retrieval system