KEGG   Aminobacter sp. MSH1: CO731_01138Help
Entry
CO731_01138       CDS       T05420                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00860  Porphyrin and chlorophyll metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CO731_01138
Enzymes [BR:amih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CO731_01138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AWC21686
UniProt: A0A2S0XF48
Position
1157335..1158051
Genome map
AA seq 238 aa AA seqDB search
MARRVLVTRPDPGATRTARRLEALGFEPVLLPLSETQPLPVTRESVPTNATAVAVTSANA
LRHAPSGLVERLSHLPCHAVGARTAEGARKAGFSSVNEGPGDAVGLADMIAIELGKATLA
YLCGRVRMPDFERRLGANGIKVVPIETYDTIALSPPPPFVRQQLGGQPVDAVLIYSARAA
AAFGTLMEMHAEADYLIRGATCFCLSGRIASALGDGFNVEVAPDPNEDALLDLLGLPD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcacgccgtgtgctggtgacgaggccggatcccggcgccacccgcaccgcgcggcgc
cttgaagcgctcggcttcgaaccagtcctgctgccgctttccgaaacccagccgctgccg
gtgacgcgcgaaagcgtgccgaccaacgccactgctgttgctgtgaccagcgccaatgcg
ctccgccatgcgccgagcgggctggtcgagcggctcagccacctgccttgccacgcggtg
ggcgcacggaccgcagagggcgcgcgcaaggcgggattttcctccgtcaacgaagggccg
ggcgatgcggtaggcctcgccgacatgatcgccatcgagctgggcaaggcaacgctggct
tatctctgcggacgcgtgcggatgccggatttcgagcggcgcctcggcgcaaacggcatc
aaggtcgtgcctatcgaaacctacgacacgatagccctttcaccgccgcctccgttcgtg
cgccagcaactcggcggccagccggtcgacgcggtgctgatctattcagcccgggcggca
gccgcattcggtacgctgatggaaatgcatgccgaggcggattacctgatacggggtgcg
acgtgtttctgcctgtcggggcgtattgcgtcggcgctgggcgacggcttcaacgtcgag
gtcgcgcccgatcccaacgaggatgcgctgctcgatcttcttggcttgccggactga

DBGET integrated database retrieval system