KEGG   Aminobacter sp. MSH1: CO731_01317Help
Entry
CO731_01317       CDS       T05420                                 

Definition
(GenBank) Farnesyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00900  Terpenoid backbone biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CO731_01317
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:amih01006]
    CO731_01317
Enzymes [BR:amih01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CO731_01317
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CO731_01317
Prenyltransferases [BR:amih01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CO731_01317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AWC21863
UniProt: A0A2S0XFM1
Position
complement(1355362..1356279)
Genome map
AA seq 305 aa AA seqDB search
MTNDSHILFETALRMRADTVETELRLLLDDRILPGEIVRPAHLMAAMRHGALNGGKRLRP
FLVLESAALFDADGDAALRVATALECVHCYSLIHDDLPAMDDDDLRRGQPTVHKAFDEAT
AILAGDGLLTHAFDIIADETTPLPAERRAALVLALARAAGPGGMVGGQALDLDAERNKPE
EAGIIRLQAMKTGALIRFACEAGAIIAGASTADRERLAEFGSAIGLAFQLADDLLDLTAD
AETMGKATGKDAAAGKATLVSLHGADWARSQLSGLVSQAHALLEPYGERAIMLKAAASFI
AERNS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgacagccatatcctgttcgaaaccgcccttcgtatgcgcgccgacaccgtc
gagaccgagctccggcttttgctcgacgaccgcatcctgcccggcgagattgtgcggccc
gcccacctgatggccgccatgcgccacggcgcgctcaacggtggcaagcggctgcggcca
ttccttgtgctggaaagtgccgcgctgttcgacgccgatggcgacgcagcccttcgtgtc
gccacggcgctcgaatgcgtgcactgctattcgctgatccatgacgacctgccggcgatg
gacgacgacgacctgcgtcgcggccagcccaccgtgcacaaggccttcgacgaggcgacc
gcgatcctggccggtgacggcctcttgacccacgccttcgacatcatcgccgacgagacc
acgccgctgccggcggaacggcgggcggcgctggtgctggccctggcccgtgctgcgggt
cccggcggcatggtcggcggccaggccctcgacctcgacgccgaacgcaacaagcccgaa
gaggccggcatcattcgcctgcaggcaatgaagaccggcgcgctgatccgcttcgcctgc
gaggctggtgccatcattgccggcgcatccacggcggaccgcgaaaggctggccgagttc
gggtcggcgatcggcctcgccttccagctcgccgacgatctgctcgacctcactgccgat
gcagaaaccatgggcaaggcaaccggcaaggatgccgccgccggcaaggcgacgctggtt
tcgctgcacggtgccgactgggcccggtcgcagctgtccggactggtcagccaggcccat
gccctgcttgaaccctatggcgagcgcgcaatcatgctcaaggcggccgcaagtttcatc
gccgaacgcaacagctga

DBGET integrated database retrieval system