KEGG   Aminobacter sp. MSH1: CO731_02133Help
Entry
CO731_02133       CDS       T05420                                 

Gene name
ytpA_1
Definition
(GenBank) Phospholipase YtpA
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CO731_02133 (ytpA_1)
Enzymes [BR:amih01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CO731_02133 (ytpA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Ser_hydrolase Abhydrolase_4 Peptidase_S15
Motif
Other DBs
NCBI-ProteinID: AWC22668
UniProt: A0A2S0XHZ8
Position
complement(2147557..2148717)
Genome map
AA seq 386 aa AA seqDB search
MPPTRPSRVVTSLPPGATEAGGIPQAASGLIRFRLAREIPLIFSARLSITLVSPDPTAAS
AKPKRLMTDLFHEIPGNPVPERATSGDFVAHDGKRLRYALFPATSHPFKGTVILLNGRNE
CIEKYFETIRDLTVRGHAVATFDWRGQGASERLLRDGHRGYVRSFDHYVRDLEAFFEQIV
LPDCRGPFFLLAHSSGALIALLAAPSMVNRVQRMVLVAPFLSVIGAPLSMKAISRIGTLL
CWLGLGRLYAAWGPRPREGTPFEINKLTSDERRYRRNMLLYETYPELSVGGPTIAWMRAA
AQASEAVREPQFMAALKVPMLIVNAGADDVVSSRDVEQFASQCRVASLLTIDGARHEILQ
EADIYREQLLAAFTAFVPGTPATADA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgacgaggccgagccgggttgtaacgtcccttcctcccggagcgacagaggcc
ggaggcatcccgcaagctgcctccggcctcattcgattccgcctcgcccgcgaaattcct
ttgattttctcggcccgcctttctatcaccctcgtatcgcctgatcccacggcagcgagt
gccaagccgaagcgcctgatgacggacctgttccacgaaatccccggcaatccggttcct
gagagggccacctccggcgactttgtcgcccatgacggcaagcgcctgcgctatgcgctg
tttccggcgacctcccatcccttcaagggcacggtgatcctgctcaacggccgcaacgag
tgcatcgagaagtatttcgagaccattcgcgacctgaccgtgcgcggccatgcggtggcc
accttcgactggcgcggccaaggcgcgtccgagcggctgctgcgtgacggccatcgcggc
tacgtcagaagcttcgaccactatgtccgcgacctcgaagccttcttcgagcagatcgtg
ctgcccgactgccgcggccccttcttcctgctcgcccattcgagcggggcgctgatcgcc
cttctcgccgcaccctcgatggtcaaccgcgtccagcgcatggtgctggtggcgccgttc
ctgtcggtcatcggcgcaccgctgtcgatgaaggcgatcagccgcatcggcaccctgctc
tgctggctcggcctcggccggctgtacgccgcatggggcccgcggccgcgcgaaggcacg
cctttcgaaatcaacaagctgaccagcgacgagcgccgctatcgccgcaacatgctgctc
tacgagacctatcccgagctgtccgtcggcgggccgaccattgcctggatgcgcgccgca
gcgcaggcgtccgaggccgtgcgcgagccgcaattcatggcagcgctcaaggtgccgatg
ctgatcgtcaacgccggcgccgacgatgtggtgtcgtcgcgcgacgtcgagcagtttgcc
agccaatgccgcgtggcctcgcttttgaccatcgacggcgcgcgccacgaaatcctgcag
gaagcggacatctaccgcgagcagttgctcgcagccttcaccgccttcgtgcccggaacg
ccggcaaccgccgacgcatag

DBGET integrated database retrieval system