KEGG   Aminobacter sp. MSH1: CO731_02173Help
Entry
CO731_02173       CDS       T05420                                 

Gene name
gatA_1
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K01426  amidase [EC:3.5.1.4]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00330  Arginine and proline metabolism
amih00360  Phenylalanine metabolism
amih00380  Tryptophan metabolism
amih00627  Aminobenzoate degradation
amih00643  Styrene degradation
amih01100  Metabolic pathways
amih01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CO731_02173 (gatA_1)
   00360 Phenylalanine metabolism
    CO731_02173 (gatA_1)
   00380 Tryptophan metabolism
    CO731_02173 (gatA_1)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CO731_02173 (gatA_1)
   00643 Styrene degradation
    CO731_02173 (gatA_1)
Enzymes [BR:amih01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     CO731_02173 (gatA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AWC22707
UniProt: A0A2S0XI69
Position
complement(2197055..2198245)
Genome map
AA seq 396 aa AA seqDB search
MNSMPDPFNSFLDMPQVPVSNAENGPLAGLRLAVKDIFDVAGLVTGCGNPGKAASSLPAD
KTAASVQVILDAGARFVGKTQTDELAFSLMGQNAHFPHPINPAAPDRVTGGSSSGSAAAV
AGALADIAGGSDTGGSIRAPASFCGLIGLRTTHDLISLDGAMKLAPSLDTFGWFARDIDT
YEKVARLLIGEDAHRGELVRPLALDWLDALPSGPAEAAEYRRMRGIAENALGPITKASPL
TFSPDELYWCFRKVQAFEAWQQHGAWISSGDRGLGPGVKERFAFGATIDAAAYQAEIARR
DAFRSELGALLGDDGILILPTVPGAAPLAGAADAELLAYRERALMLLCLSGLSGFPQITL
PIGTVDGAPFGLSLLGPAGSDLALIQLGRQVLQQQL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcatgcccgaccctttcaactcgttcctcgacatgccacaagtgcctgtttcc
aatgcggaaaacggcccgcttgcggggctgcggctggctgtcaaggacatcttcgatgtt
gccggcctcgtcaccggctgcggcaatcccggcaaggctgccagcagccttccggccgac
aaaactgccgcgtcagtgcaggtgattctcgatgcgggcgcgcgattcgtcggcaagacc
cagaccgacgaactcgccttttcgttgatgggccagaacgcgcattttccgcacccgatc
aatcccgcggcacccgaccgcgttaccggcggctcatcatctggttcggccgccgcagtc
gccggcgcgcttgccgacatcgcagggggctcggacaccggtggctcgatccgggcaccg
gccagtttctgcgggctgatcggcctgcgcacgacccatgatctcatctcgctcgacggc
gcaatgaagctcgcccccagcctcgacacattcggctggttcgcccgggacatcgacacc
tatgagaaagtggccaggctgctcatcggcgaggatgcccatcgcggcgaactggtccgg
ccgcttgcgctcgactggctcgacgcgctgccctccggcccggccgaggcagccgaatac
cggcgcatgcgcggcatcgccgaaaacgcccttggccccataaccaaggcgtcacccctc
accttttcgcccgacgaactctactggtgcttccgcaaggtccaggcctttgaggcctgg
cagcagcatggcgcgtggatatcgtccggagaccgcggcctcgggccaggcgtcaaggag
cgcttcgcctttggcgcgaccatcgatgccgcggcctatcaggcagagatcgccaggcgc
gacgctttccgcagcgaactcggcgcattgctgggcgatgacggcatcctgatcctgccg
accgtgccgggcgcggccccactagccggcgcggcggacgccgaattgctggcctatcgc
gagcgcgcgctgatgctgctttgcctgtcggggctttccggcttccctcagatcaccctg
cccatcggcacggtggacggcgcaccattcggcctgtcgctgctgggacctgccggcagc
gatctggcgctcatccagttgggacgccaagtactgcagcagcaactttag

DBGET integrated database retrieval system