KEGG   Aminobacter sp. MSH1: CO731_02338Help
Entry
CO731_02338       CDS       T05420                                 

Gene name
leuA_1
Definition
(GenBank) 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00290  Valine, leucine and isoleucine biosynthesis
amih00620  Pyruvate metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01210  2-Oxocarboxylic acid metabolism
amih01230  Biosynthesis of amino acids
Module
amih_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CO731_02338 (leuA_1)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CO731_02338 (leuA_1)
Enzymes [BR:amih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     CO731_02338 (leuA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like LeuA_dimer
Motif
Other DBs
NCBI-ProteinID: AWC22870
UniProt: A0A2S0XIH7
Position
complement(2362717..2364384)
Genome map
AA seq 555 aa AA seqDB search
MPTAAVKYQAYHKINLPDRTWPSKVIDKAPIWCSVDLRDGNQSLVDPMGHDRKARMFQLL
LDMGFKEIEIGFPSASQTDFDFARWCIEEGNVADDVSLQVLVQCRPELITRTFEALKGAH
KPIVHFYNSTSELQRRVVFGKDVAGIKQIATDAAKMITDMAAKAGGGYRFQYSPESFTGT
ELEVALEICNAVTEIIRPTPDNKLIINLPSTVEMATPNIYADQIEWMCRNLDNRENLIIS
LHPHNDRGTGIAATELGLMAGADRVEGTLFGNGERTGNVDVVTLALNMFTQGVDPELDCS
DIERIKAVYEYSNQMVIPERHPYVGELVYTAFSGSHQDAINKGMKAIKVANKPLWEVPYL
PIDPQDVGRSYEAIIRINSQSGKGGIAYVLQADYGLNLPRSLQVEFSQDIQAITDAEGKE
VSVKRIHERFLEVYVDQPAARLKFVDHQTFPDTVMKGRRVVEATIVDNGKEVVISGTGNG
PIDGFVDALSRHIGIDLSVLDYSEHSIQRGSNASAICYMEVEHPRGRLFGAGINTNIVAA
SLEAVVSAANRILTR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccgccgccgtcaagtatcaagcctatcacaagatcaacctgcccgaccggacc
tggccgtccaaggtcatcgacaaggcgccgatctggtgctcggtcgacttgcgcgacggc
aaccagtcgctcgtcgacccgatgggccacgaccgcaaggcgcgcatgttccagctgctg
ctcgacatgggtttcaaggaaatcgagatcggctttccctcggcgtcgcagaccgatttt
gattttgcccgctggtgcatcgaagagggcaacgtcgccgacgacgtgtcgctgcaggtg
ctcgtgcagtgccggccggaattgatcacgcgcaccttcgaggcgctgaagggcgcgcac
aagccgatcgtgcatttctacaactcgaccagcgagttgcagcgccgcgtggtgttcggc
aaggacgtcgccggcatcaagcagatcgccaccgacgccgccaagatgatcaccgacatg
gcggccaaggccggcggcggctaccgcttccagtattcgccggaaagcttcaccggcacc
gaactcgaagtcgcgctggagatctgcaacgcggtcaccgagatcatcaggccgacgccc
gacaacaagctgatcatcaacctgccctccaccgtcgagatggcgacgcccaacatctat
gccgaccagatcgagtggatgtgccgcaacctcgacaatcgcgagaacctgatcatctca
ctgcatccccacaacgatcgcggcaccggcatcgctgccaccgagctcggcctgatggcg
ggtgccgaccgtgtcgaaggcacgctgttcggcaatggcgagcgcaccggtaacgtcgac
gtggtgacgctggcgctcaacatgttcacccagggcgtcgaccctgaactcgactgttcg
gacatcgagcggatcaaggccgtctacgaatattccaaccagatggtcattcccgaacgc
cacccctacgtcggcgaactggtctacaccgccttctccggctcgcaccaggacgctatc
aacaagggcatgaaggcgatcaaggtcgccaacaagccgttgtgggaagtgccttacctg
ccgatcgacccgcaggacgtgggccgcagctacgaggcgatcatccgcatcaactcgcag
tcgggcaagggcggcatcgcctatgtgctccaggccgactacggcctcaacctgccgcgc
agcctgcaggtggagtttagccaggacatccaggcgatcaccgatgccgaaggcaaggaa
gtgtcggtcaagcgcatccatgaacgcttcctcgaagtctatgtagaccagccggccgca
cgcctcaaattcgttgatcaccagacctttcccgatactgtgatgaagggccgccgcgtc
gtcgaggcgaccattgtcgacaacggcaaggaagtggtgatttccggaaccggcaacggc
ccgatcgacggattcgtcgatgccctgtcccgccatatcgggatcgacctttcggtgctc
gactattccgagcattcgatccagcgcggctccaacgcttcggccatctgctacatggag
gtcgagcatccgcgcggacgcctgttcggcgccggaatcaacaccaatatcgtggcggct
tcccttgaagcggtggtttcggcggccaatcgcatcctgacgcgttag

KEGG   Aminobacter sp. MSH1: CO731_04239Help
Entry
CO731_04239       CDS       T05420                                 

Gene name
leuA_2
Definition
(GenBank) 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00290  Valine, leucine and isoleucine biosynthesis
amih00620  Pyruvate metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01210  2-Oxocarboxylic acid metabolism
amih01230  Biosynthesis of amino acids
Module
amih_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CO731_04239 (leuA_2)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CO731_04239 (leuA_2)
Enzymes [BR:amih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     CO731_04239 (leuA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like LeuA_dimer Urocanase_C
Motif
Other DBs
NCBI-ProteinID: AWC24748
UniProt: A0A2S0XNX8
Position
complement(4319429..4321045)
Genome map
AA seq 538 aa AA seqDB search
MARERIYLFDTTLRDGQQTPGIDFSVEDKIAIAAMLDEFGLDYVEGGYPGANPTDTAFFQ
EKRTKRAKFVAFGMTKRAGVSTSNDPGLATLLQARSDGICYVAKSWDYHVRVALGVTNEE
NLESIRASVEAARDAGKEPMVDCEHFFDGFKANPDYALACARTAYEAGARWVVLCDTNGG
TQPSEVREIVAKVIASGIPGANLGIHAHDDTGQAVANSLAAIEAGVRQVQGTINGIGERC
GNANLITIIPTLALKPHFAGRFETGVSEEALAGISRLSRAFDELLNRAPEAQSPYVGASA
FATKAGIHASAIAKEPKTYEHVPPEAVGNRRKVMVSDQGGKANFVAELKRRGIDVPRDDG
RLDALISVVKEREAEGYAYEGADASFELLARSMLHTVPDFFRVTSFRCLVERRFDANGNL
KTVSEAVVKVMVDGEEKMSVAEGDGPVNALDIALRKDLGKFQHEIGDLELADYKVRILNG
GTEAITRVLIESHDSTGARWWTVGVSTNIIDASFQALMDSIIYKLMKNRDMAGLVAAE
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgaacgcatctatctcttcgacacgacgctgcgcgacggccagcagacgccg
ggcatcgacttctccgtcgaggacaagatcgcgatcgccgccatgctcgacgagttcggg
ctcgactatgtcgagggcggctatcccggtgccaatcccaccgacacggccttcttccag
gagaagcgcaccaagcgggcgaaattcgtcgccttcggcatgaccaagcgggcaggggtg
tcgacctccaacgacccgggcctcgccacgctgctgcaagccaggtcggacggcatctgc
tacgttgccaagagctgggattaccacgtccgcgtcgcgctcggggtcaccaacgaggag
aacctcgaatcgatccgcgcctcggtcgaggcggcgcgcgacgccggcaaggagccgatg
gtcgactgcgagcacttcttcgacggcttcaaggccaatcctgactacgcgctggcctgc
gcccgcactgcctatgaggccggcgcgcgctgggtggtgctgtgcgacaccaatggcggc
acccagccgtcggaggtgcgcgagatcgtggccaaggtcatcgcatccggcattcccggc
gccaatcttggcatccatgcccatgacgacaccggccaggcggtggccaattcgctggcc
gccatcgaggccggcgtgcgccaagtgcaaggcaccatcaacggcatcggcgagcgctgc
ggcaacgccaacctgatcaccatcatcccgacgctggcgctgaagccgcatttcgccggg
cgtttcgagacaggcgtttcggaagaggcgttggcaggcatctcgcggctttcgcgcgca
ttcgacgaattgctcaaccgcgcgcctgaggcgcagtcgccctatgtcggcgcctccgcc
tttgccaccaaggccggtatccacgcctcggcgatcgccaaggagcccaaaacctacgaa
cacgtgccgccggaagccgtcggcaaccggcgcaaggtgatggtgtcggaccagggcggc
aaggccaacttcgtcgccgagctgaagcgccgcggcatcgacgtgcccagggacgacgga
cggctggacgcgctgatttcggtggtcaaggaacgcgaggccgagggttatgcctatgag
ggcgccgacgccagcttcgagctcctggcgcgcagcatgctgcacacggtgccggatttc
ttccgcgtgacctcgttccgctgcctggtcgaacggcgtttcgacgccaacggcaacctc
aagaccgtgtcggaagcggtggtgaaggtgatggtcgatggcgaggagaagatgtcggtg
gccgaaggcgacggccccgtcaacgcgctcgacatcgccctgcgcaaggacctcggcaag
ttccagcacgagatcggcgacctggagctggcggactacaaggtgcgtatcctcaatggc
ggcaccgaggcgataacccgcgtcctgatcgagtcgcatgacagcaccggcgcgcgctgg
tggaccgtcggggtgtcgaccaacatcatcgacgcttcgttccaggcgctgatggattcg
atcatctacaagctgatgaaaaaccgcgacatggcggggttggtggcagcggagtag

DBGET integrated database retrieval system