KEGG   Aminobacter sp. MSH1: CO731_02632Help
Entry
CO731_02632       CDS       T05420                                 

Gene name
metC_2
Definition
(GenBank) Cystathionine beta-lyase MetC
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00270  Cysteine and methionine metabolism
amih00450  Selenocompound metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01230  Biosynthesis of amino acids
Module
amih_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CO731_02632 (metC_2)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CO731_02632 (metC_2)
Enzymes [BR:amih01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     CO731_02632 (metC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AWC23163
UniProt: A0A2S0XJC6
Position
2655059..2656240
Genome map
AA seq 393 aa AA seqDB search
MRDETRLLHTAVDEQPFNALTPAVHRGSTIVFPTVESFLARHTQFYDGYSYGLYGHPASR
NLATQIAALEGGARSLIVPSGMAAIMVTNLALLRAGDHVLLPDAVYGPSRSSAEKFMSGL
GVDATFYDPLIGAGITALMRPNTKLVWVELPASFTMEVQDLPAIAKAAHAHGALVAADGT
WASPLGFKALHHGADIAVQALSKHIGGHSDLLLGSATVASEELYRRIKDASRFLGLGVSP
DDCFLALRGLGTLAARLERQSTAALKIAERIAEHPSVARVLYPPLPGDPGHAIWQRDFRG
ASGVFSAVLQPRDDRHLSTFIEQLRLFRIGASWGGLHSLVAPVQLEGARTVSPWREEGPL
VRFSIGLEHPDDLLEDIELGLDRYGFHREAAAE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgaaacccgtctccttcacaccgctgtcgacgaacagcccttcaacgcgttg
acgccagcggtccaccgcggctcgaccatcgtgttcccgacggttgagagtttcctcgcc
cgccacacgcagttctacgacggctattcctatgggctttatggccacccggcctccaga
aacctggcgacccagatcgccgcgctcgaaggcggcgcccgcagcctcatcgtgccgtcg
ggcatggcggcgatcatggtcaccaatctggcgctgcttcgcgccggcgatcatgttctc
ttgccggacgccgtctatggaccgtcgcgttcgtcagccgaaaagttcatgtcgggtctc
ggggtcgacgcaacgttctatgatccgctgatcggcgccggcatcaccgccctgatgcgt
ccgaacaccaagctggtgtgggtggaattgccggcctcgtttacgatggaggtccaggat
ctcccggcgatagccaaggccgcccatgcccacggcgcgcttgtcgccgccgacggcacc
tgggcctcgccgctgggtttcaaggcgctgcaccatggcgccgacattgcggtgcaggca
ctgtcgaaacatatcggcggccactcggacctgctgctgggcagcgccacggtcgcctcg
gaggagttgtaccggcgcatcaaggacgccagccgcttcctcgggctgggcgtttcaccc
gacgattgcttcctggcgctgcgcggcctgggcacgctagccgcccggctggagcgccaa
agtactgccgccttgaagatcgccgagcgcattgccgaacatcccagcgttgctcgcgtg
ctctatccaccgctgcccggcgatccggggcatgcgatctggcagcgtgacttccgaggc
gcgagcggcgtcttttccgcggttctgcagccgcgtgacgatcgccatctgtcgaccttc
atcgaacaattgcgcctgttccgtatcggcgcgagttggggcggcctccacagcctggtc
gcgcccgtgcaactcgaaggcgcccgcacagtatcgccctggcgcgaagaggggccgctc
gttcgcttcagcatcggcctcgagcatcccgacgacctgttggaggacatcgaactcggg
ctcgaccgctacggcttccaccgggaggcggcagccgaatga

KEGG   Aminobacter sp. MSH1: CO731_04150Help
Entry
CO731_04150       CDS       T05420                                 

Gene name
metC_3
Definition
(GenBank) Cystathionine beta-lyase MetC
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00270  Cysteine and methionine metabolism
amih00450  Selenocompound metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01230  Biosynthesis of amino acids
Module
amih_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CO731_04150 (metC_3)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CO731_04150 (metC_3)
Enzymes [BR:amih01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     CO731_04150 (metC_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AWC24661
UniProt: A0A2S0XNS9
Position
4229568..4230740
Genome map
AA seq 390 aa AA seqDB search
MTRDNGRIKGVNTRLAHSGHDPHGFHGFVNPPVVHASTVLYPNAATMAARAQKYTYGTRG
TPTTDALCAAIDELEGSAGTIAVPSGLAAVTIPLLGFLSAGDHILITDSVYHPTRHFADT
MLKRLGVEVDYYDPHVGAGIAALIKPNTKVVLTESPASNTFEIQDIPAISKAAHVAGAIV
MMDNTWATPLYFKALDFGVDVTIHAATKYPAGHSDVLSGTVSANADCWPRLREAFFTLGC
CAGPDDVYQVLRGLRTMGVRLAHHEKSALDIARWLEGQPGVARVLHPGLESHPDHELFKR
DFGGSSGIFSVVLSGGGQNKAHAFLDALEIFGLGYSWGGFESLAVPVNLSDRKVVTPYEG
PIIRLQIGLEDVADLKEDIAAGLQAANAAE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgactcgagacaacggcaggatcaaaggcgtcaacacgcggctcgcgcattccggccac
gatccacacggctttcatggctttgtcaatccgccggtggtccacgcctcgacggttctt
tatcccaacgctgcaacgatggcggcgcgtgctcaaaaatacacatatggcacccgcgga
acgccgacgacggatgccctttgcgcggccatcgacgaactggaaggctcggccggcacc
atcgccgtgccttcggggcttgcggccgtcaccatccccctgcttggcttcctctcggcc
ggcgaccacatcctgatcaccgattccgtctaccacccgacgcgccacttcgccgacacc
atgctcaagcgtctcggtgtcgaggtcgactactacgatccgcatgtcggcgccggcatc
gccgccctcatcaagccgaacaccaaggtggtgctcaccgaatcgcccgcctcgaacaca
ttcgagatccaggatatcccggccatatcaaaggcagcccatgtcgccggtgcgatcgtc
atgatggacaacacctgggccacgccgctctatttcaaggcgctcgatttcggcgtcgac
gtcaccatccacgcggcgaccaaataccccgccggccattccgatgtgctgagcggcacg
gtttcggcaaacgccgactgctggcccaggcttcgcgaggcgttcttcacgcttggctgc
tgcgccggtcccgacgacgtctaccaggtgctgcgcggcctgcgcaccatgggcgtccgg
ctcgcccatcacgaaaagagcgcgctggacatcgcgcgctggctcgaaggccagccgggc
gtggcccgcgtgctgcacccggggctcgaaagccaccccgaccacgaactgttcaagcgc
gacttcggcggctccagcggcatcttctccgtggtgctgtccggcggcggccagaacaag
gcacacgccttcctcgacgcgctcgagatcttcggcctgggctattcctggggtggtttc
gagagcctggctgtgccggtcaacctcagcgaccgcaaggtggtcaccccttatgagggc
ccgatcatccgcctgcagatcgggcttgaagatgtcgccgacctcaaggaagatattgcg
gccgggctgcaagccgccaacgcggcggagtga

DBGET integrated database retrieval system