KEGG   Aminobacter sp. MSH1: CO731_02899Help
Entry
CO731_02899       CDS       T05420                                 

Gene name
cobL
Definition
(GenBank) Precorrin-6Y C(5,15)-methyltransferase [decarboxylating]
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00860  Porphyrin and chlorophyll metabolism
amih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CO731_02899 (cobL)
Enzymes [BR:amih01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     CO731_02899 (cobL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase PCMT Methyltransf_4 Cons_hypoth95 Methyltransf_25 Methyltr_RsmB-F MTS
Motif
Other DBs
NCBI-ProteinID: AWC23428
UniProt: A0A2S0XK52
Position
complement(2932025..2933257)
Genome map
AA seq 410 aa AA seqDB search
MPAEFDAPTQKWLTVVGIGEDGVAGLGDEAKRAISGAAHVFGGKRHLTLAVELIRGAARP
WPTPFDSEMRDVVALRGQKICVLASGDPFLHGVGVTLSRVVPSTEMRVLPAPSAFSLAAS
RLGWALQDIETVSLHGHAIDLIRPLLQPSGRVIALTSDGEAPAQIAALIADSGFGASRLT
VLEALGGENERIRVTTAGGFDLENINPLNVLALELESSPQARTLPLASGLADDLFEHDGQ
ITKREIRAVTLSTLAPRRGELLWDIGAGSGSISVEWMLCHPSLRAIAIEHNAERADRIER
NASACGVPGLKVVRGAAPDALTRLPTPDVIFIGGGGSDAGVFDTAIAALRSGGRLVANAV
TLEMETLLLARHAALGGELLRLQVSRAAPVGTMTGWRPAMPVTQWSWVKP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgagttcgacgcaccgacgcaaaaatggctgaccgtcgtcggcatcggcgag
gacggtgtagcgggtctcggcgacgaggccaagcgcgcgatatcaggcgctgcccacgtc
ttcggcggcaagcgccatctgacgctcgccgtcgaactgatccgcggcgcagcacggcct
tggccgacgcccttcgacagcgaaatgcgcgatgtcgttgccctgcgcggccaaaaaatc
tgcgtgctggcctcgggtgatccgttcctccatggcgtcggcgtcacgctctcgcgtgtc
gtgccatcaaccgagatgcgtgtcttgcccgccccgtcggccttctcgctggcggcgtcg
cggcttggctgggccctgcaggacatcgagacggtgtcgcttcatggccacgctatcgac
ctgatccgaccgctgctgcaaccgagcgggcgcgtcatcgcgctgacctccgacggcgaa
gcgcccgcacagatcgcagcactcatcgccgacagcggcttcggcgcatcgcgcctgaca
gtgctcgaagcgctgggcggtgaaaatgagcgcatccgtgtcacgaccgctggtggcttc
gatctcgaaaacatcaacccgctcaacgtcctggcgctggagcttgaatcaagtccgcag
gcacgaaccctgccgttggcctcgggccttgcagacgatctgttcgagcatgacggccag
atcaccaagcgcgagatccgcgccgtgacgctgtcgaccctcgcgccccgccgtggcgag
cttctgtgggacatcggcgccggctccggctcgatatccgtcgaatggatgctctgccac
ccctcgctgcgcgccatcgccatcgagcacaatgccgagcgcgccgaccgcatcgagcgc
aacgccagtgcctgcggcgtgccgggcctgaaggttgtccggggtgctgcaccggacgcc
ttgacccgcctgccgacgcctgacgtcatcttcatcggcggcggcggttcggatgcaggc
gtcttcgatacggccatcgcagcccttcgttccggcggccgcctcgtcgccaacgccgtc
acgctcgaaatggaaacgctgctgctcgcccgccatgccgcgctcggcggtgagcttctg
cgccttcaagtctcccgcgccgcccctgttggcacgatgaccggctggcggccggcgatg
ccggtcacgcagtggagctgggtcaagccatga

DBGET integrated database retrieval system