KEGG   Aminobacter sp. MSH1: CO731_03349Help
Entry
CO731_03349       CDS       T05420                                 

Gene name
cdsA
Definition
(GenBank) Phosphatidate cytidylyltransferase
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00564  Glycerophospholipid metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
Module
amih_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CO731_03349 (cdsA)
Enzymes [BR:amih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     CO731_03349 (cdsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_1 CarS-like
Motif
Other DBs
NCBI-ProteinID: AWC23876
UniProt: A0A2S0XLD6
Position
3377782..3378612
Genome map
AA seq 276 aa AA seqDB search
MSNLQLRTISAIVLATAVLALTWGGGLPFRLLSAAIVLAIFYEWSTMSRAKTGAVWAAGD
LGILPEVAILLLAGALVAGVPALALIGLVAAFTLILWIVGLMRGVAAWEAAGFGYAALSG
LSLALLRGNDASGLVAILFLFAVVWATDIFAYFVGRKVGGPKLAPAISPGKTRSGALGGA
VGGVVAGLLLASTAGSGNLALLAVVALLLSVISQAGDLFESWVKRRHGYKDSGSLIPGHG
GVMDRVDGLVAAAFALYVIGWMSGSADHPAQGLFPA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctccagcttcggacaatctcggcgatcgtgctggcgacggcggtgctcgcc
ctgacctggggcggcggcctgccgtttcgcttgctgtcggcggcgatcgtcctagccatt
ttctacgaatggtcgaccatgtcgcgcgccaagaccggcgcggtctgggccgctggcgat
cttggcatcctgcctgaagtggcgatcctgctgttggccggggcgctcgtcgccggcgtg
cccgcgcttgccctgatcggcctggtcgccgcattcacgttgattctctggatcgtgggg
ctgatgcgcggggtggcggcatgggaagccgccggattcggctacgcagcgctctccggc
ctgtctttggccctcctgcgcggcaatgacgcatccgggctggtcgccatcctgtttctg
ttcgcggtcgtctgggcgaccgacatcttcgcctatttcgtcggccgcaaggtcggcgga
ccaaagctcgcgcctgcgatctcacccggcaagacccgtagcggcgcactcggcggagcc
gttggcggcgtcgtggccgggctattgctcgcaagcaccgctggtagcggcaatcttgcg
ctgctggctgttgtcgcgctgctgctgtcggtgatttcccaggccggcgacctgttcgaa
tcctgggtcaagcgccggcatggctacaaggactcgggctcgctgattcccggtcatggc
ggcgtgatggaccgggtggacgggcttgtcgcggctgcatttgccctatacgtcatcggc
tggatgtccggttcggccgatcatccggcgcaggggctgtttccagcctga

DBGET integrated database retrieval system