KEGG   Aminobacter sp. MSH1: CO731_03357Help
Entry
CO731_03357       CDS       T05420                                 

Gene name
gltA_1
Definition
(GenBank) Citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00020  Citrate cycle (TCA cycle)
amih00630  Glyoxylate and dicarboxylate metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
amih01210  2-Oxocarboxylic acid metabolism
amih01230  Biosynthesis of amino acids
Module
amih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amih_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
amih_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CO731_03357 (gltA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    CO731_03357 (gltA_1)
Enzymes [BR:amih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     CO731_03357 (gltA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-ProteinID: AWC23884
UniProt: A0A2S0XLE4
Position
complement(3386941..3388230)
Genome map
AA seq 429 aa AA seqDB search
MTDSTAKLEFRGQTHEFKVRAGTVGPDVIDIASLYATTGAFTYDPGFTSTASCESEITFI
DGDAGILLHRGYPIDQLAEHGDFLEVCYLLLYGELPTKSQKDDFDHRVTRHTMVHEQMSR
FFTGFRRDAHPMAVMCGVVGALSAFYHDSTDISDPHQRMVASIRLIAKMPTIAAMAYKYH
IGQPFVYPKNELNFAANFLHMCFAVPCEEYKVNPVLARAMERIFILHADHEQNASTSTVR
LAGSSGANPFACIAAGIACLWGPAHGGANEAALNMLSEIGHVDRIPEFVARAKDKNDPFR
LMGFGHRVYKNYDPRAKIMQKTTHEVLGELGIKDDPMLDVAMELERIALTDEYFIEKKLY
PNIDFYSGITLKALGFPTTMFTVLFALARTVGWIAQWKEMIEDPRQKIGRPRQLYTGAAE
RDYLPIAKR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgattcgaccgccaaactggagttccgcggccagacccacgagttcaaggtgcgc
gccggaacggtcggaccagatgtgatcgacatcgcatcgctctacgccaccaccggcgcc
ttcacctacgaccccggcttcacctcgacggcgagctgcgagtcggagatcaccttcatc
gacggcgatgccggcatcctgctgcaccgcggctacccgatcgaccagttggccgagcac
ggcgatttcctcgaggtctgctacctcctgctctatggcgaactgccgaccaagtcccag
aaggacgacttcgaccatcgcgtcacgcgccacaccatggtgcatgagcagatgtcgcgc
ttcttcaccggcttccgccgcgacgcgcacccgatggctgtcatgtgcggcgttgtcggt
gccctgtcggccttctatcacgactcgaccgatatctcggatccgcaccagcgcatggtc
gcttcgatccgcctgatcgccaagatgccgacgatcgcggcgatggcctacaagtaccat
atcggccagcccttcgtttaccccaagaacgagctgaactttgccgccaacttcctgcac
atgtgctttgccgtgccgtgcgaggagtacaaggtcaatccggtgctcgcccgcgccatg
gagcgcatcttcatcctccatgccgaccacgagcagaatgcctcgacctctaccgtgcgc
ctcgccggttcctcgggcgccaacccgttcgcctgtatcgcagccggcatcgcctgcctg
tggggtccggcccatggcggcgccaatgaagcggcgctcaacatgctgagcgaaatcggc
catgtcgaccgcattccggagttcgtcgcccgcgccaaggacaagaacgatccgttccgc
ctgatgggcttcggccaccgcgtctacaagaactacgatccccgcgccaagatcatgcag
aagaccacgcatgaagtgctcggcgagctcggcattaaggacgatccgatgctcgacgtc
gcaatggagctcgagcgcatcgcgctaaccgacgaatacttcatcgaaaagaagctctac
ccgaacatcgacttctactcgggcatcacgctgaaggcgctgggcttccccacgaccatg
ttcaccgtgctgttcgcgctcgcccgcaccgtcggctggatcgcgcagtggaaggaaatg
atcgaggatccgcgccagaagatcggccgtccgcgccagctctacaccggtgctgccgag
cgtgactatctgccgatcgccaagcgctag

KEGG   Aminobacter sp. MSH1: CO731_03998Help
Entry
CO731_03998       CDS       T05420                                 

Gene name
citA
Definition
(GenBank) Citrate synthase 1
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00020  Citrate cycle (TCA cycle)
amih00630  Glyoxylate and dicarboxylate metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
amih01210  2-Oxocarboxylic acid metabolism
amih01230  Biosynthesis of amino acids
Module
amih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amih_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
amih_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CO731_03998 (citA)
   00630 Glyoxylate and dicarboxylate metabolism
    CO731_03998 (citA)
Enzymes [BR:amih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     CO731_03998 (citA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt LexA_DNA_bind
Motif
Other DBs
NCBI-ProteinID: AWC24509
UniProt: A0A2S0XN85
Position
complement(4045632..4046420)
Genome map
AA seq 262 aa AA seqDB search
MPIGKARTATTEICIAAANAVEVRGRDLCSDLMGRLSFTAYFYLLLTGREPTEDQRYFLD
LLLVAIAEHGMMPTVQAARMTLASDPNALQGALAAGVLGCGPVILGTSELCGALLLKARA
RVTEGGDADEVVLELAREIREAGGKAPGFGHPVHRPLDPRAERILELADQRGVSGPHVDL
ARRMREAVAQVWGKTLVLNVSMPIAAVLLDLDFPPAFLKAIPLLARTGGLLAHLAEEQQN
PIGFVLAGHAEAAVSYGANSRT
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcggtaaagcgcgcacagccaccactgaaatctgtatcgcggcagcaaacgca
gtcgaagtgcgaggcagggatctctgcagcgatctcatgggtcggctgagcttcactgcg
tatttctatctgctcttgaccgggcgcgagccgactgaagatcagcgctacttcctggac
ctcttgctcgttgcgatcgccgaacacgggatgatgcccactgtccaggcggcgcggatg
actctcgcctccgatcccaatgcactacagggcgcgttggccgcgggtgttctcggctgc
ggccccgtaatccttggtacctccgaactctgcggcgcgcttctcctaaaggcgcgtgcc
cgggtgaccgagggcggggatgccgacgaggtcgtcctggagttggctcgtgaaatccgt
gaagcgggcggaaaggcgccgggtttcgggcatcctgtgcaccggccgctcgacccgcgc
gccgagcgcatcctggaacttgccgaccagcgcggcgtcagcggcccgcatgtcgatctg
gcgcggcgcatgcgcgaggcggtggcgcaggtatgggggaagacgctcgtcttgaacgtc
tcgatgccgattgccgcagtcctgctcgatctcgacttccctcccgcatttctcaaggcg
atcccgctgcttgcccgcaccggcggcctccttgctcatcttgcggaagaacagcaaaac
cccatcggctttgtcctcgccggccatgcggaagcggccgtttcctacggtgccaatagc
aggacctga

DBGET integrated database retrieval system