KEGG   Aminobacter sp. MSH1: CO731_03364Help
Entry
CO731_03364       CDS       T05420                                 

Gene name
trpD
Definition
(GenBank) Anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01130  Biosynthesis of antibiotics
amih01230  Biosynthesis of amino acids
Module
amih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CO731_03364 (trpD)
Enzymes [BR:amih01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     CO731_03364 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AWC23891
UniProt: A0A2S0XLI8
Position
complement(3395784..3396794)
Genome map
AA seq 336 aa AA seqDB search
MSALKPHIAKVAAGAPLTFEEAREAFDIIMSGEATPGQIGGFLMALRVRGETVSEISGAV
ATMRDKMLRVEAPADAIDIVGTGGDGSHSVNISTASAFVIAGAGVPVAKHGNRGLSSLTG
AADVLTALGVNIDLAPEAIGRCIHEAGVGFMFAPAHHPAMKHVGATRVELGTRTIFNLLG
PLSNPAGVNRQLVGVFSPEWVEPVAETLKELGAQHVWVVHGDGYDEITTTGETRVAALAN
GAISTFTLTPEQVGLARHTREELRGGDSTYNAAALRGVLEGTAGAYRDTVLMNAGAGLVV
ADKVATIGEGVKLAADAIDSGRALAVLQRLVGVSNG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcactcaagcctcacatcgccaaggtcgccgctggcgcccctctcaccttcgag
gaagcgcgcgaggccttcgacatcatcatgtcgggcgaagcgacgccggggcagatcggc
ggcttcctgatggcgctgcgcgtgcgcggcgaaacggtcagcgaaatctccggcgccgtc
gccaccatgcgcgacaagatgcttcgcgtcgaagcgccggctgacgccatcgacatcgtc
ggcactggcggcgatggctcgcacagcgtcaacatctcgaccgcctcggccttcgtcatc
gccggcgccggcgttcccgttgccaagcacggcaaccgcggcctgtcttcgctgacaggt
gccgctgacgttctgaccgcactcggcgtcaacatcgacctggcgcccgaagcgatcggc
cgctgcatccatgaggccggcgtcggcttcatgttcgcgccggcgcaccatccggcgatg
aagcatgtcggcgcgacacgcgtcgaactcggcacccgcaccatcttcaatcttctcggg
cccctctccaatccggccggcgtcaaccgccagctggtcggcgtgttctcgcccgaatgg
gtcgagccggtcgccgaaacgctaaaggaactcggcgcccagcacgtctgggtcgtccac
ggcgacggctatgacgagatcaccacgacaggcgaaacccgtgtcgcagcactcgccaat
ggcgccatcagcactttcacgctgacccccgaacaggtcggcctggcgcgccatacgcgc
gaagagctgcgcggcggcgattccacctacaacgcagcggctttgcgcggcgtgctcgaa
ggcactgccggcgcgtatcgcgacacggtgctgatgaatgctggtgccggactggttgtc
gccgacaaggtggcgaccatcggtgaaggcgtgaagctcgcggcggatgcgatcgacagc
ggtcgcgccctggccgtgctgcagcgcctcgtcggcgtctcgaacggataa

DBGET integrated database retrieval system