KEGG   Aminobacter sp. MSH1: CO731_03514Help
Entry
CO731_03514       CDS       T05420                                 

Gene name
metG_2
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00450  Selenocompound metabolism
amih00970  Aminoacyl-tRNA biosynthesis
amih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CO731_03514 (metG_2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CO731_03514 (metG_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amih01007]
    CO731_03514 (metG_2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amih03016]
    CO731_03514 (metG_2)
Enzymes [BR:amih01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CO731_03514 (metG_2)
Amino acid related enzymes [BR:amih01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CO731_03514 (metG_2)
Transfer RNA biogenesis [BR:amih03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CO731_03514 (metG_2)
 Prokaryotic type
   Other AARSs
    CO731_03514 (metG_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Herpes_ICP4_N
Motif
Other DBs
NCBI-ProteinID: AWC24038
UniProt: A0A2S0XLV8
Position
3560020..3561561
Genome map
AA seq 513 aa AA seqDB search
MSREKFYITTAISYPNGKPHIGHAYELIATDALARFQRHDGKDVFFLTGTDEHGIKMLQT
ANREGISARELADRNSNEFKKMATLLNASNDDFIRTTEERHYAASQAIWKAMADRGDIYK
SSYAGWYSVRDEAYYGEEETEVRPDNIRYGPQGTPVEWVEEESYFFRLSAYQDKLLALYD
NQPDFIGPNERRNEVASFVRSGLKDLSISRTTFDWGVPVPGDDKHVMYVWVDALTNYITA
LGYPDTNAKKWAYWPAVHIIGKDIVRFHAVYWPAFLMSAGIELPKRVFGHGFLFNRGEKM
SKSLGNVVDPFTMVEHYGLDQVRYFLLREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ
RSLSMIAKNCNGVVPQRGELADADNAILDQATAALATARKAMAEQGIHHALAAIFAVVAE
ANRYFAAQEPWALKKTDPARMETVLWTTAEVIRRVGIMCQPFIPESASKLLDLLAVTDRD
FVHVDAAHALVSGAPLPAPQPVFPRYVEQATEH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcgaaaaattctacatcacgaccgcgatctcctatcccaacggcaagccgcat
atcggccatgcctatgagctgattgccaccgacgcacttgcccgcttccagcgccatgac
ggcaaggacgtgttcttccttaccggcaccgacgagcacggcatcaagatgctgcagacg
gccaaccgggaaggcatctcggcgcgcgagttggcagatcgtaattcgaatgaattcaag
aagatggcgactcttctgaatgcgtcgaacgatgatttcatccgcaccaccgaagagcgc
cactatgccgcctcgcaggcgatctggaaggcgatggccgaccgcggcgacatctacaag
agcagctatgccggctggtattcggtgcgcgacgaagcctattacggcgaagaagagacc
gaggtccgtcccgacaacatccgctacggcccgcagggcacgccggtcgaatgggtcgag
gaagagagctacttcttccggctgtcggcctatcaggacaagctgctggcgctctatgac
aaccagcccgacttcatcggccccaacgagcgccgcaacgaggttgcgagcttcgtccgc
tcgggcctgaaggacctgtcgatctcgcgcacaaccttcgactggggcgtgccggtgccg
ggcgacgacaagcacgtgatgtatgtctgggtcgacgccctgaccaactacatcaccgcc
cttggctatcccgacaccaacgccaagaagtgggcctactggcctgccgtgcacatcatc
ggcaaggacatcgtgcgtttccatgccgtgtactggccggcgttcctgatgtctgccggc
atcgaattgcccaagcgcgtgttcggccacggcttcctgttcaaccgcggcgagaagatg
tcaaagtcgctcggcaacgtcgtagacccgttcaccatggtcgagcactacggcctcgac
caggtgcgctatttcctgctgcgcgaagtgccgttcggccaggatggcagctacagccat
gaggcgatcgtcaaccgcaccaatgccgatcttgccaacgatctcggcaacctggcgcag
cgctcgctgtcgatgatcgccaagaactgcaatggcgtggtgccacagcgcggcgaactg
gcagacgccgacaatgccatcctcgaccaggcaaccgcagcactggccacggcacgcaag
gcaatggcggagcaggggatccaccacgcgcttgcggcgatcttcgccgtggtcgcggaa
gcgaaccgctactttgcggcacaggagccgtgggcgctgaagaagaccgatccggcgcgc
atggaaacggtgctgtggacgacggccgaggtgatccgccgcgtcggcatcatgtgccag
cccttcattcccgagtcggcatcgaagctgctcgacctgcttgccgtgaccgaccgggat
tttgttcacgtcgatgccgcgcatgcgctggtctcgggtgcgcccttgccggcaccccag
ccggtattcccgcgctatgtcgagcaggcaacggaacactga

DBGET integrated database retrieval system