KEGG   Aminobacter sp. MSH1: CO731_03572Help
Entry
CO731_03572       CDS       T05420                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
amih  Aminobacter sp. MSH1
Pathway
amih03010  Ribosome
Brite
KEGG Orthology (KO) [BR:amih00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CO731_03572 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:amih03011]
    CO731_03572 (rplV)
Ribosome [BR:amih03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CO731_03572 (rplV)
  Bacteria
    CO731_03572 (rplV)
  Archaea
    CO731_03572 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AWC24096
UniProt: A0A2S0XM10
Position
complement(3615537..3615926)
Genome map
AA seq 129 aa AA seqDB search
MGKAKAPRRLADNEARAVLRTIRVSPQKLNLVAALIRGKKVATALSDLEFSRKRIAGTVK
KTLESAIANAENNHDLDVDALVVAEAFVGKSIVMKRFHARGRGRASRIEKPFSHLTIVVR
EVEEKGEAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggccaaagctccgcgcaggcttgctgacaacgaggcacgtgcggtcctccgc
acgatccgggtcagcccgcagaagctcaacctcgttgccgcgctgatccgcggcaagaag
gtagcgaccgcgctttccgatctggaattttcgcgcaagcgcatcgccggtacggtcaag
aagaccctcgaatcggctatcgctaacgcggaaaacaatcacgacctcgatgtcgacgcg
ctggtggtggcggaagcctttgttggcaagtcgatcgtcatgaagcgtttccacgctcgt
ggccgtggtcgcgccagccgcatcgagaagccgttttcgcacctcacgatcgtcgttcgt
gaagtcgaagagaaaggggaggccgcataa

DBGET integrated database retrieval system