KEGG   Aminobacter sp. MSH1: CO731_03791Help
Entry
CO731_03791       CDS       T05420                                 

Gene name
panC
Definition
(GenBank) Pantothenate synthetase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00410  beta-Alanine metabolism
amih00770  Pantothenate and CoA biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CO731_03791 (panC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CO731_03791 (panC)
Enzymes [BR:amih01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     CO731_03791 (panC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase Glyco_hydro_100
Motif
Other DBs
NCBI-ProteinID: AWC24307
UniProt: A0A2S0XMR8
Position
3840805..3841650
Genome map
AA seq 281 aa AA seqDB search
MTVVVETIAALRAQVQAWRAEGLKVALVPTMGALHDGHVSLMRAALERADRCVVSIFVNP
RQFAPTEDLDKYPRQLVLDLDKLKQAGVHLAFTPGVDEVYPQGFATSISVAGPSAGLETA
FRPAFFDGVATVVAKLFIQAAPDLAVFGEKDYQQLCVVKKLCLDLDLPVEVLGSPTIRDA
EGLAMSSRNAYLDAAELDIARKLNKVLRKAASLLRSGANEQATMAAARQQILDAGFDVVD
YVEARESVMLAPWRKDRDGRVMVAARLGKTRLIDNIEISAS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgtcgtcgaaaccatcgccgccctgcgcgcgcaagtgcaggcgtggcgtgcc
gagggcctgaaagtcgcgctggtgccgaccatgggcgcgctgcatgacggccacgtctcg
ctgatgcgcgcggcccttgagcgcgccgaccgctgcgtcgtctcgatcttcgtcaatccg
cgccagttcgcaccgaccgaagacctcgacaagtacccgcgccagctggtgctcgacctc
gacaagctgaagcaggcaggcgtccacctcgccttcacgcccggcgtcgacgaagtctac
ccgcaaggctttgccacttcgatctcggtcgctggcccgtcggccggtcttgaaacggcc
ttccgcccggcctttttcgacggcgtggccacagtcgtcgccaagctgttcatccaggcg
gcacccgacctcgccgtgtttggcgagaaggactatcagcagctctgcgtggtcaagaag
ctgtgcctcgacctcgacctgccggtggaggtcctgggctcgccgacgatccgcgacgcc
gaaggcctcgccatgtcgtcacgcaatgcctatctcgacgcggcggaactcgacatcgcg
cgcaagctcaacaaggtgctgcgcaaggcagcgtcgctgcttcggtcaggcgccaacgag
caggcgaccatggctgccgcgcgccagcagatcctcgatgccggcttcgacgtcgtcgac
tatgtcgaggcgcgggaaagcgtgatgctggcgccatggcggaaggaccgcgacggccgc
gttatggtcgctgcccgcctcggcaagacgcgcctcatcgacaatatcgagatatcggcc
agctaa

DBGET integrated database retrieval system