KEGG   Aminobacter sp. MSH1: CO731_04577Help
Entry
CO731_04577       CDS       T05420                                 

Gene name
ribBA
Definition
(GenBank) Riboflavin biosynthesis protein RibBA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00740  Riboflavin metabolism
amih00790  Folate biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CO731_04577 (ribBA)
   00790 Folate biosynthesis
    CO731_04577 (ribBA)
Enzymes [BR:amih01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CO731_04577 (ribBA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CO731_04577 (ribBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 PUA
Motif
Other DBs
NCBI-ProteinID: AWC25083
UniProt: A0A2S0XPT9
Position
complement(4653104..4654201)
Genome map
AA seq 365 aa AA seqDB search
MPYDQKKVVEALRAFERGEIVVVMDDDGRENEGDLIVAAVHCTAEKMAFIVRHTSGIVCT
PMLKEDARRLNLTPMVADNDSAHTTAFTVSVDFKHGTTTGISAEDRTLTVRNLANGNVGG
SDFVRPGHIFPLIAREGGVLMRSGHTEAAVDLCKLAGLPPVGVISELVNDDGTVMRGPQV
ASFAEKNGLKQVSVADLIAYRQRQETLIERVDTFDIETPAGTAKAITYTLPWDVMHHLAI
VFGDIRDGEEVPVRLHTEDVVTDVFGTSNRLGDIMKTFGECKRGVIVYLREGSVGVSNLG
RNRPSAEREDHEEARHREDEWRQIGLGAQILKDLGISSINLVASRERHYVGLEGFGIRIA
KTEIR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgccatacgatcagaagaaagttgtcgaagcgctgagagccttcgagcgcggtgagatc
gtggtcgtcatggacgatgacgggcgcgaaaacgagggcgacctgattgtcgccgccgtc
cattgcacggccgagaagatggcgttcatcgtccgccatacctccggcatcgtctgcacg
ccgatgctgaaggaagatgccagacggctcaacctgacgccgatggtcgccgacaatgat
tccgcgcacacgacggcgttcaccgtcagcgtcgacttcaagcatggcaccacgaccggc
atctcggccgaggatcgcacgctgaccgtgcgcaacctcgccaacggcaatgtcggcggc
tccgacttcgtccgcccgggccacatcttcccgctgatcgcccgcgaaggcggcgtcctg
atgcgctcgggccataccgaggctgccgtcgacctgtgcaagctcgccggcctgccgccg
gtaggtgtcatttccgaactggtgaacgacgacggtaccgtcatgcgcggcccgcaggtt
gcctcctttgccgagaagaatggcctcaagcaggtttcggtcgccgatctgatcgcctac
cgccagcgccaggagacgctgatcgagcgcgtcgatactttcgacatcgagaccccagcc
ggcacggccaaggccatcacctacacgctgccgtgggacgtcatgcaccacctcgcgatc
gtcttcggtgacatccgcgacggcgaggaagtgccggtgcgcctgcacaccgaggacgtg
gtgaccgacgtgttcggcaccagcaaccgcctcggcgacatcatgaagaccttcggcgag
tgcaagcgtggcgtcatcgtctatctgcgcgaaggatcagtcggcgtttccaatctcggc
cgcaaccggccttcggccgaacgcgaggatcatgaagaggcccgccatcgtgaagacgaa
tggcgccagatcggcctcggggctcagatcctgaaggatctcggcatctcctcgatcaac
ctggttgcctcgcgcgaacgccactatgtcggcctcgaaggttttggcatccgcatcgcc
aagaccgaaatccgctga

DBGET integrated database retrieval system