KEGG   Aminobacter sp. MSH1: CO731_04607Help
Entry
CO731_04607       CDS       T05420                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00900  Terpenoid backbone biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CO731_04607 (ispE)
Enzymes [BR:amih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CO731_04607 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AWC25113
UniProt: A0A2S0XPW6
Position
4680489..4681355
Genome map
AA seq 288 aa AA seqDB search
MTFNSVPLAELAPAKINLALHVTGRRADGYHLLETLVVFAEFGDRITVTASGEDSFFVAG
PFAGSVPRDAGNLVLRARDALRGAYPAHATQPVSITLEKHLPVASGIGGGSSDAAATLRA
LTRLWRIPADAAALARLALPLGADLPMCIAGHPLIARGIGEELDPVRHFPALPMVLVNPG
VAVETPKVFRALASRDNPALAPLDSADTVLDWLGATRNDLEGAAMSIEPSIAEVLAALRR
SGTAFARMSGSGATCFGIFDSAAAASRAATAISSEHPGWFSTATMTRT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttcaacagcgttccgctcgccgaactcgccccggccaagatcaatctcgcgctg
catgtcaccggccggcgcgccgacggctaccacctgcttgaaacgctcgtcgtgttcgcc
gagttcggcgaccgtatcaccgtgacggcttcgggcgaagacagcttcttcgtcgccggt
cccttcgccggtagcgttccgcgcgatgccggcaacctcgtgctgcgtgcccgcgacgcc
ctgcgtggggcttatcccgcccatgcgacccagccggtttcgatcacgctcgaaaagcac
ctgccggtcgcttccggcatcggcggcggttcgagcgatgcggcagcgacgttgcgggcg
cttacccgcctctggcgcatcccggccgacgccgccgcactggcccgcctcgccctgccg
ctcggcgccgacctgccgatgtgcatcgccgggcacccgctgatcgcccggggcatcggc
gaggagctcgatccagtcaggcacttcccggccctgccgatggtgctggtcaatcccggc
gtcgcggtggagacgcccaaggtgttccgcgcgctggcctcgcgcgacaaccccgccctt
gcgccgctcgacagcgccgacacggtgctcgactggctcggcgcgacccgcaacgacctg
gaaggtgctgcgatgtcgatcgaaccgtccatcgccgaggttctggcggcacttcgccgc
tcgggtactgccttcgcccgcatgtcgggctccggcgcgacctgcttcggcatcttcgac
agtgccgccgccgcttcgcgtgccgccaccgcgatctcaagcgaacaccccggctggttc
agcaccgccaccatgacacggacctag

DBGET integrated database retrieval system