KEGG   Aminobacter sp. MSH1: CO731_04801Help
Entry
CO731_04801       CDS       T05420                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00030  Pentose phosphate pathway
amih00480  Glutathione metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
Module
amih_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
amih_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
amih_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CO731_04801 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CO731_04801 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amih04147]
    CO731_04801 (zwf)
Enzymes [BR:amih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CO731_04801 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CO731_04801 (zwf)
Exosome [BR:amih04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CO731_04801 (zwf)
  Exosomal proteins of colorectal cancer cells
   CO731_04801 (zwf)
  Exosomal proteins of bladder cancer cells
   CO731_04801 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AWC25306
UniProt: A0A2S0XQF7
Position
4892283..4893752
Genome map
AA seq 489 aa AA seqDB search
MTSQIIPVDPFDFIIFGGTGDLSERKLLPALYHRQRDHQFSEPTRIIGASRTKMDDKEFR
AFAKKAISDHVKPEYIEEAELKTFLDRLSYVTVDAKSGDGFAELKKSVGDSKRIRVFYLA
VAPSLFGDISDHLKAHKLVTADSRIVVEKPIGRDLESAKALNDIIGDDFGEHQIFRIDHY
LGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAETVGLEDRVTYYDKAGALRDMVQN
HILQLLCLVAMEAPASMDANAVRDEKLKVLNALKRVNGNEAPKQTVRGQYRAGASAGGPV
KGYIEELGADSTTETFVAIKAEIANWRWAGVPFYLRTGKRLASRVSEIVIEFKPIPHSIF
GESAGPIFNNQLVIRLQPDEGVKQFIMIKDPGPGGMRLRQIPLDMSFAQSFDGRAPDAYE
RLIMDVVRGNQTLFMRRDEVEAAWKWIDPIQHAWEGSRQEAQGYTAGTWGPSASIALIER
DGRTWHESN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacaagccagatcatccccgtcgatcctttcgacttcatcattttcgggggcaccggc
gatttgtcggagcgcaagctgctgccggcgctctatcaccgccagcgcgaccaccagttt
tccgagccgacgcgcatcatcggggcgtcgcgcaccaagatggacgacaaggaattccgg
gccttcgccaagaaggcgatctccgatcacgtcaagccggaatacatcgaagaggccgag
ctcaagaccttcctcgaccggctcagctacgtcaccgtcgacgccaagtccggcgacggc
tttgccgagctgaagaagtcggttggcgacagcaagcgcatccgcgtcttctacctcgcc
gtggcaccgagcctgttcggcgacatttccgaccacctcaaggcgcacaagctggttacg
gccgactcgcgcatcgtcgtggaaaagccgatcggccgcgatctggagtcagccaaggcg
ctgaacgacatcatcggcgacgatttcggcgagcaccagatcttccgcatcgaccactat
ctcggcaaggagacggtgcagaacctgatggcgttgcgctttgccaacgcgctctacgag
ccactgtggaactccgcccatatcgaccatgtgcagatcacggtggccgagaccgtcggc
ctggaagaccgcgtcacctactacgacaaggcaggcgcgctgcgcgacatggtgcagaac
cacatactgcaattgctctgcctcgtcgccatggaagcgcccgcctcgatggacgcgaat
gcggttcgcgacgaaaagttgaaggttctcaacgcgctgaagcgggtcaacggcaacgag
gcgcccaagcaaacggtgcgcggccagtaccgcgccggcgcttccgccggcggtccggtg
aaaggctacatcgaggaactcggtgccgacagcaccaccgagaccttcgtcgccatcaag
gccgagatcgccaactggcgctgggccggcgtgccgttctacctgcgcaccggcaagcgg
ctggcgtcgcgcgtctccgaaatcgtcatcgagttcaagccgatcccgcattcgatcttc
ggcgaaagtgccgggccgatcttcaacaaccagctggtcatccgcctgcagccggacgaa
ggcgtcaagcagttcatcatgatcaaggacccgggtccgggcggcatgcgcctgcgtcag
atcccgctcgacatgagctttgcccagtcgttcgacgggcgcgcgccggacgcctatgaa
cgcctgatcatggacgtggtgcgcggcaaccagacgctgttcatgcgccgcgacgaggtc
gaggcggcgtggaaatggatcgacccgatccagcacgcctgggaaggcagccgccaggaa
gcccagggttacaccgccggcacctggggtccgtctgcgtcgatcgcgctgatcgagcgc
gacggccgcacctggcacgagagcaattga

DBGET integrated database retrieval system