KEGG   Aminobacter sp. MSH1: CO731_04825Help
Entry
CO731_04825       CDS       T05420                                 

Gene name
paaJ
Definition
(GenBank) 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00071  Fatty acid degradation
amih00280  Valine, leucine and isoleucine degradation
amih00281  Geraniol degradation
amih00362  Benzoate degradation
amih00592  alpha-Linolenic acid metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01130  Biosynthesis of antibiotics
amih01212  Fatty acid metabolism
Module
amih_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CO731_04825 (paaJ)
   00592 alpha-Linolenic acid metabolism
    CO731_04825 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CO731_04825 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CO731_04825 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CO731_04825 (paaJ)
   00642 Ethylbenzene degradation
    CO731_04825 (paaJ)
Enzymes [BR:amih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     CO731_04825 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AWC25330
UniProt: A0A2S0XQJ6
Position
complement(4918546..4919751)
Genome map
AA seq 401 aa AA seqDB search
MAEAYICDYIRTPIGRFGGSLSSVRADDLGAVPLRVLMERNPSVDWAAVDDVIFGCANQA
GEDNRNVARMSLLLAGLPQEVSGTTINRLCGSGMDALIAAARAIKAGEAELMIAGGVESM
SRAPFVMPKADAAFSRHAEIHDTTIGWRFVNPVMKKQYGVDSMPETGENVAEDFSVSRAD
QDTFAVRSQNKAVAAQENGRLGKEITPVTIPQRKGDAIVVAKDEHPRAGTTIEMLAKLPT
PFRQGGTVTAGNASGVNDGAAALIVASEAAVKKYGLTPIARVLGGAAAGVAPRIMGIGPA
PATKKLCARLGISPADFDVIELNEAFASQGIAVLRELGIAEDAEHVNPNGGAIALGHPLG
MSGARIAGTAALELGLRGGKLALATMCIGVGQGIAVALERA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcctatatctgcgattacatccgcaccccgatcggccgctttggcggctcg
ctgtcgtcggtccgcgcagacgatctcggcgccgtgccgctcagggtgctgatggagcgc
aatccttccgtcgattgggctgcagtcgatgacgtgatcttcggctgcgccaaccaggcc
ggcgaggacaaccgcaacgtagcccgcatgtcgctgcttttggcgggactgccgcaggaa
gtctccggcacgaccatcaatcgcctctgcggttcgggcatggacgcgctgattgcggct
gcccgcgccatcaaggccggcgaagccgagctgatgattgccggtggcgtcgagagcatg
agccgcgcgcccttcgtcatgcccaaggccgacgcggctttctcgcgccatgcagagatc
cacgacaccaccatcggctggcgcttcgtcaacccggtgatgaaaaagcagtacggcgtc
gattcgatgcccgagaccggtgagaacgtcgcggaggacttttccgtctcccgcgccgat
caggatacctttgccgtgcgcagccagaacaaggccgtcgccgcgcaggaaaacggtcgc
cttggcaaggagatcaccccggtgacgatcccgcagcgcaagggcgatgcgatcgtcgtt
gccaaggatgagcatccgcgcgccggcacgaccatcgagatgctggccaagttgccgacg
ccgttccgtcagggcggcacggtgaccgccggcaacgcttccggcgtcaacgacggcgcg
gcagccctcatcgttgcctccgaagctgcggtgaagaagtatggcctgacgccgatcgct
cgcgtgcttggcggtgcggcggcgggcgtagcaccgcgcatcatgggcatcggcccggca
ccggcgaccaagaagctgtgcgcccgtctcggcatcagcccggccgacttcgacgtcatc
gaactcaatgaagcttttgcctcccaaggcatcgccgtgctgcgcgaactcggcatcgcc
gaggatgcggagcacgtgaacccgaatggcggggccatcgcactgggccatccgctgggc
atgtcgggcgcccgcatcgccggtaccgcggcgctggagctcggcctgcgcggtggcaag
ctggcgcttgccaccatgtgcatcggtgtcgggcagggtatcgcggtcgcactcgagcgc
gcctga

DBGET integrated database retrieval system