KEGG   Aminobacter sp. MSH1: CO731_05022Help
Entry
CO731_05022       CDS       T05420                                 

Gene name
hemA
Definition
(GenBank) 5-aminolevulinate synthase
  KO
K00643  5-aminolevulinate synthase [EC:2.3.1.37]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00260  Glycine, serine and threonine metabolism
amih00860  Porphyrin and chlorophyll metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CO731_05022 (hemA)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CO731_05022 (hemA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amih01007]
    CO731_05022 (hemA)
Enzymes [BR:amih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.37  5-aminolevulinate synthase
     CO731_05022 (hemA)
Amino acid related enzymes [BR:amih01007]
 Aminotransferase (transaminase)
  Class II
   CO731_05022 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AWC25525
UniProt: A0A2S0XR73
Position
5061781..5063058
Genome map
AA seq 425 aa AA seqDB search
MNYQRFFEEAIDQIHAERRYRVFADLERIVGKFPRAIWRANGKAEEITVWCSNDYLGMGQ
HPDVVAAMQKAAGNMGTGAGGTRNISGNNHPLVELELELADLHGKEAGLVFTSGFVSNEA
AISTIARLLPNCLILSDELNHASMIEGVRRSGAEKKIFRHNDVAHLESLLQAAGRERAKL
IVFESVYSMDGDIAPIEAIADLAEKYNAMTYIDEVHAVGMYGPRGGGITEREGLAHRIDI
IEGTLAKAFGTLGGYITGTREVIDAVRSYAPGFIFTTALPPAIAAATTVSIRHLKNSQAE
RDAQQRQATHAKQVLADAGLPVMESPTHIVPILVGDPELCKMASDRLLGVHGLYIQPINY
PTVPRGTERLRITPTPFHTDELIAELKLALVETWNALGIPYRGAGHTEVAQSDRIIPLLV
PKSGG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccagcggtttttcgaagaagcgatcgaccaaatccacgccgagcgccgttat
cgcgtgtttgcggatctggagcgcatcgtcggcaagttcccgcgcgccatctggagagcc
aacggcaaggccgaggaaatcaccgtctggtgctcgaacgactatctcggcatgggccag
catcccgacgtggtggcggccatgcagaaggcggccggcaacatgggcaccggtgccggc
ggcacgcgcaacatctccggcaacaaccatccgctggtcgagctcgagcttgaactcgcc
gacctgcacggcaaggaagccggcctggtcttcacctcgggcttcgtctcgaacgaggct
gcgatctcgaccatcgcccggctgctgccgaactgcctgatcctgtcggacgaactcaac
cacgcctcgatgatcgaaggcgtgcgccgctcgggcgccgaaaagaagatcttccgccac
aacgacgtcgcccacctcgaaagcctgctgcaggctgcgggccgcgagcgcgccaagctg
atcgtgttcgagagcgtctattcgatggacggcgacatcgcgccgatcgaggcgatcgcc
gacctcgccgagaagtacaacgccatgacctatatcgacgaggtccacgcggtcggcatg
tacggtccgcgcggcggcggcatcaccgagcgcgaggggctcgcccatcgcatcgacatc
atcgagggcacgctggccaaggcattcggcacgctcggcggctacatcaccggcacccgc
gaagtcatcgacgccgtgcgctcctacgcaccgggcttcatcttcaccaccgcgctgccg
ccggcgatcgccgccgcgaccactgtgtcgatccgccatctcaagaactcgcaggccgag
cgcgacgcccagcagcgccaggcgacgcacgccaagcaggtgcttgccgacgccggattg
ccggtcatggagtcgccaacgcatatcgtgccgatcctcgtcggcgatccggaactgtgc
aagatggccagcgaccgcctgctcggcgtccacggcctctacatccagccgatcaactac
ccgacggtgccgcgcggtaccgagcggctgcgcatcacgccgacgccgttccataccgac
gagctgatcgccgaactcaagcttgcgctggtcgagacgtggaatgcactcggcattccc
tatcgcggcgccggccataccgaggttgcgcagagcgaccgcatcattccgcttctggtg
cccaagtccggcggctga

DBGET integrated database retrieval system