KEGG   Aminobacter sp. MSH1: CO731_05212Help
Entry
CO731_05212       CDS       T05420                                 

Gene name
phhA
Definition
(GenBank) Phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00360  Phenylalanine metabolism
amih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amih00790  Folate biosynthesis
amih01100  Metabolic pathways
amih01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CO731_05212 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CO731_05212 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CO731_05212 (phhA)
Enzymes [BR:amih01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     CO731_05212 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AWC25711
UniProt: A0A2S0XRU2
Position
5242519..5243352
Genome map
AA seq 277 aa AA seqDB search
MGISVQDYAQECAAQGLRGDYTVCRPDFTVEQKYDYSAAEQEVWRTLCDRQTKLTQRLAH
KSYLDGMSALGLVDRIPDFHDVSEKLRKLSGWEIVAVPGLIPAQPFFDHLANRRFPVTNW
LRTREELDYIVEPDMFHDFFGHVPVLSQPVFGDFMQMYGEKAGDLIALGGDEMTTRLYWY
TAEYGLMREAGQPLKAFGAGLMSSFTELQFAVESPDAHHVPFDIETVMRTTYEIDKFQRA
YFVLPSFDVLRDAFQNSDLAGIIKRWKDEPPLDPATI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcagcgttcaggactacgcgcaggaatgtgcggcccaagggttgcgtggcgac
tacacggtctgccgccccgacttcaccgtcgaacagaaatacgactacagcgccgccgag
caggaggtgtggcgcacattgtgcgaccgccagaccaagctgacccagaggctggcgcac
aaatcctatctcgatggcatgtcggcgctcggcctcgtcgaccgcattccggactttcac
gacgtcagcgagaagctgcgcaagctctccggctgggagatcgtcgcggtgcccggcctg
atcccggcacagccgttcttcgatcatctcgccaatcgccgttttcccgtcaccaactgg
ctgaggacccgcgaagagctcgactacatcgtcgagcccgacatgttccacgacttcttc
ggccatgtgccggtgctgagccagccggtgttcggcgacttcatgcagatgtatggcgag
aaggccggcgacctgatcgcgctcggcggcgacgagatgaccacccgactctactggtac
acggcggaatacggcctgatgcgtgaagccggccagccgctcaaggcattcggcgcaggg
ctgatgtcgtcgttcacggaactgcagttcgccgtcgaaagccccgatgcccaccatgtc
ccgttcgacatcgagacggtgatgcgcacgacctacgagatcgacaagttccagcgcgcc
tatttcgtgctgccgtcgttcgacgtcctcagggacgctttccagaactccgacctggcc
ggcatcatcaagcgctggaaggatgagccgccgctcgacccggcgacgatctag

DBGET integrated database retrieval system