KEGG   Aminipila sp. JN-39: EQM06_00155Help
Entry
EQM06_00155       CDS       T05806                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
amij  Aminipila sp. JN-39
Pathway
amij00051  Fructose and mannose metabolism
amij01100  Metabolic pathways
amij01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amij00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EQM06_00155
Enzymes [BR:amij01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     EQM06_00155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: QAT41759
UniProt: A0A410PS91
Position
33296..34666
Genome map
AA seq 456 aa AA seqDB search
MHCRHLRTRGFIRKSFGDKSMKVEKLKPSEQLCKVMSRIYDSGLTTVSGGNLSLKDEYDN
IWVTPSGGDKGRYQPEDMLKIGRDGKIQGTRKPSVETGIHRSILADRPEFKGVVHAHPSG
LVAISLLRQLPETMLFPQVANEVRNVRLAAYGCPGSEELRANVAKEFKDNPTTNTAILEN
HGAFVASEKGLSHAFGIFKDLDFSIRVQAKAHSFWGKGPNLISKEQLERYNRALRPALGT
FKQGEISEKERELRALMCDFCSRAYQRKLFTQNIGVISARLEGENFLITESDSDNAELTA
SEIVKVCGSTAEEGKTPSKSVLLHKRIYETNPDIHAIIMAAPENAMVFAVTDREYDLKTI
PECYIVLREDIAKFPFGSTIEKQEELADYFKRKSPVAIVKNDCYICTGENLFNAFDRLEV
VEFSAEAVMNANLLKGQIKSITEQQVHEIKVKFGIV
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcactgcaggcatttaaggacaaggggctttatccggaaaagctttggagataaatct
atgaaggtagaaaagctgaaaccatccgagcagctgtgtaaagttatgtccagaatttat
gattccggacttacgacggtttcgggaggaaatctttcattaaaagatgagtatgataat
atctgggtcactccttccggcggggataaaggaagatatcagccggaggacatgttaaaa
ataggacgggacggaaaaatacagggaaccagaaagccttctgtggagactgggattcat
cggtctattttagcggatcgccctgaatttaaaggcgtggttcacgctcatccttccgga
ttggtagccatcagcctcttaaggcagctgccggagaccatgctatttcctcaggtcgcg
aatgaggtcaggaatgtgagattggcagcttacggctgtccgggcagtgaagagcttcgg
gcaaatgtagcaaaggagtttaaagacaatccgacgaccaatacggcaattcttgaaaac
cacggagcttttgttgccagcgaaaaaggactgtcccatgcctttggtatttttaaggat
ttagatttcagcatccgggttcaggcaaaggcccacagcttttggggcaaaggtccgaat
cttatctcaaaagaacagctggagcggtacaaccgggctttaagacctgcgttggggacc
ttcaaacagggagaaatctcagagaaggagcgggagctgagagcgcttatgtgtgatttt
tgcagccgagcgtatcaaagaaagctgtttactcagaacatcggcgtaatatctgcccgt
ctggaaggggagaattttctgattacagagagtgactcagataatgccgagctgactgct
tcggaaatcgtcaaggtgtgcggatcgacagcagaagagggcaaaactccgtctaaaagc
gtgttgcttcataaaaggatatatgagacgaacccggatatacatgctattataatggct
gctccggaaaatgccatggtattcgccgtgacagatcgggaatacgatttaaagaccatt
ccggaatgctatatcgttttgagagaggacatagcaaaatttcctttcggatcaaccata
gaaaaacaggaggaattggccgattattttaagagaaagtctccggtagctattgtcaaa
aatgactgctatatttgtaccggagaaaatctttttaatgcctttgatcgtcttgaagtg
gttgaattcagcgcagaggccgtgatgaatgcaaacctgcttaaaggacagataaagagc
attaccgagcagcaggttcatgaaataaaggtgaaatttgggattgtgtaa

DBGET integrated database retrieval system