KEGG   Aminipila sp. JN-39: EQM06_05960Help
Entry
EQM06_05960       CDS       T05806                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
amij  Aminipila sp. JN-39
Pathway
amij00430  Taurine and hypotaurine metabolism
amij00620  Pyruvate metabolism
amij00640  Propanoate metabolism
amij00680  Methane metabolism
amij01100  Metabolic pathways
amij01120  Microbial metabolism in diverse environments
amij01200  Carbon metabolism
Module
amij_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:amij00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EQM06_05960
   00640 Propanoate metabolism
    EQM06_05960
  09102 Energy metabolism
   00680 Methane metabolism
    EQM06_05960
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    EQM06_05960
Enzymes [BR:amij01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     EQM06_05960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: QAT42813
UniProt: A0A410PV66
Position
1310621..1311823
Genome map
AA seq 400 aa AA seqDB search
MKVLVINCGSSSLKYQVLDMTNEVLLCKGLVERIGMEGAVITHEKIGMDKFKLVVPMKDH
KEAIGHVLEAVQDENHGVVKSMDEIGAVGHRVVHAGEKYAHSVLITEEVLKALEECVELA
PLHNPPNLAGIAACQALMPKTPMVAVFDTAFHQTMPPESYIYAIPYEYYQKHGIRRYGFH
GTSHKYVAERAADIMNCALDDLKIITCHLGNGASVSAIKRGKCIDTSMGFTPLEGLVMGT
RSGDIDPAIVTYIRDKENLEAGVANDILNKKSGVLGISGISSDFRDIEEAAAEGNERAQL
ALKVFAHKVRFYIGAYIAEMNGVDAIVFTAGVGENDIEMRDIICNDLGNLGIKLDLVKNK
VRGKETIISRDDSRVKIILIPTNEELMIARDTYDITKNLK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattagtaatcaactgtggaagttcatcattaaaatatcaggttcttgatatg
acaaatgaagttcttttatgcaaaggtcttgtagaaagaatcggcatggaaggtgcagtc
atcacacacgagaaaatcggtatggacaagtttaagctcgtagttcctatgaaggaccat
aaagaagcgattggacatgtattggaagctgtacaggatgaaaatcatggtgttgtgaag
tccatggatgaaatcggagctgttggacacagagtcgtacacgcaggtgaaaaatatgct
cactcagtactgatcacagaagaggttctaaaagccctggaagaatgcgtggaattggct
cctcttcacaatccgcctaatctggcaggtattgcagcgtgtcaggcattaatgccaaag
acgccgatggtagccgtattcgatacagcctttcatcagaccatgcctcctgaatcatac
atttatgcgattccttatgaatattatcagaagcatggaatcagaagatatggtttccac
ggaacaagccataaatatgtagccgaaagagcagctgatatcatgaactgtgcactggat
gatttgaagatcattacctgccatttaggaaacggcgcatctgtttccgctattaagaga
ggcaagtgtatcgatacttccatgggcttcactccgctggagggtctggttatgggtact
cgttcgggagacatcgaccctgctatcgttacgtatatccgagacaaagaaaatttagag
gccggtgttgctaatgacatcttaaataagaaatccggtgttcttggaatttccggtata
tccagcgactttagggatattgaagaagcggctgcggaaggaaatgaaagagcacagctt
gcattaaaggtatttgctcataaggtacgattctatatcggtgcttatattgcggaaatg
aacggcgtggatgccattgtatttactgccggcgttggtgaaaatgacatcgagatgaga
gacatcatctgtaacgatcttggaaatttaggcatcaagcttgaccttgttaagaataag
gtaagaggaaaagaaaccatcatcagcagagatgattccagagtaaaaattattctgatc
cctacgaacgaagaactgatgattgccagagacacatatgatattacaaagaatttaaaa
taa

DBGET integrated database retrieval system