KEGG   Aminipila sp. JN-39: EQM06_07565Help
Entry
EQM06_07565       CDS       T05806                                 

Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
amij  Aminipila sp. JN-39
Pathway
amij00740  Riboflavin metabolism
amij00790  Folate biosynthesis
amij01100  Metabolic pathways
amij01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amij00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    EQM06_07565
   00790 Folate biosynthesis
    EQM06_07565
Enzymes [BR:amij01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     EQM06_07565
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     EQM06_07565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: QAT43104
UniProt: A0A410PW09
Position
complement(1653368..1654570)
Genome map
AA seq 400 aa AA seqDB search
MFKYNRIEEALEALRQGKIIVVTDAENRENEGDLICAAEFANAENVNFMATYGKGLICMP
MSRKLADRLGLGPMVHKNTDNHETAFTVSIDHKDTTTGISAIERSITAMKSVEDSVSPED
FRKPGHMFPLAAKDFGVLEREGHTEATVDLVRLAGLKECGLCCEIMRADGTMMRTSELKS
FAQEHGLVFITIEALKEYRKRTEKLVEQVVRTKLPTIYGEFTAYGYINKINGEHHVALVK
GKIEKESPTLCRVHSECLTGDALGSVKCDCGEQYKAAMKKIQKESRGVMLYMRQEGRGIG
LVNKLRAYALQDQGLDTVEANLALGFEEDLREYSIAAQILKDLGVQDVRLMTNNPDKVQQ
LSRYGVHISQRVPLEVEANPYDMVYLKTKQTKMGHLLSCD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatataatagaattgaagaggcgttggaagcgttgaggcaggggaaaataatt
gtcgtaacggatgctgagaacagagaaaatgaaggagacctcatttgtgctgctgaattc
gccaatgcagaaaatgtaaactttatggcaacttatgggaaaggtttgatttgtatgccc
atgagcagaaaactggccgatcgattaggcttgggtccaatggttcataagaatacagat
aatcatgagactgcgtttaccgtatccattgatcataaggatacaacgacaggaatttcg
gcaatcgagaggtccataactgctatgaaatccgtggaggatagtgtaagccccgaagat
ttcagaaaaccgggacatatgtttccgctggccgccaaggactttggggtactggaaaga
gaggggcatacggaggcaacagtggatttggtcagactggccgggcttaaggaatgcggg
ttatgttgtgaaataatgcgggcggacggaacgatgatgcgcacttccgaattaaaaagc
ttcgcccaggagcacggactggtttttataacaattgaagcgttgaaagagtacagaaag
cgtacagaaaaattggtggaacaggtggtaaggactaagcttcctactatttatggggaa
tttacagcctatgggtatatcaataagataaacggagaacaccacgtggcactggtcaaa
ggtaagatagaaaaggaaagtccgaccctttgcagagttcattccgaatgcctgacagga
gatgctttgggttcggtcaaatgtgactgcggagaacagtataaggcagctatgaagaaa
atacaaaaggaaagccggggagtaatgctttatatgaggcaggagggccgcggaatcggc
cttgtaaataagctgagggcttatgcccttcaagatcaaggtcttgacacggtggaagca
aatttggctctgggatttgaagaggatttgagagagtattccatagctgctcagatcctg
aaagatttaggcgtgcaggatgtgaggctgatgaccaataatcccgataaggtacagcag
ctttcaaggtatggagtccatatttcccaacgagttcctcttgaagtggaagcaaatcca
tatgacatggtttacttaaaaacaaaacaaactaaaatggggcatcttctaagttgtgat
taa

DBGET integrated database retrieval system