KEGG   Aminipila sp. JN-18: EQM06_12580
Entry
EQM06_12580       CDS       T05806                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
amij  Aminipila sp. JN-18
Pathway
amij00472  D-Arginine and D-ornithine metabolism
amij01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amij00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    EQM06_12580
Enzymes [BR:amij01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     EQM06_12580
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: QAT43989
UniProt: A0A410PYF3
Position
complement(2705938..2708148)
AA seq 736 aa
MTELKHNEKLDVQNILKDLDKYEPRRRGWHWRTPAPGIKMGPFEYHDCSEPLKNSVGLPP
AKFFGDIDPQPLPVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRHMGQSHIDGLMEGT
PQGIGGVPITRKQVRAQRKALDLIEDEVGRPINYHSYVSGVAGPDVAVMFAEEGINGAHQ
DPQYNVLYRDINCVRSFVDACESKKVMAWAEMLQIDGAHNANATAREAWKVMPELIVQHA
INALFSEKVGIKPELISLSTVPPTATPAPCVYMDLPYAVALRDICGRYKMRAQQNTKYIC
SSTREATVTHVLNMLISKLTSADIQSTITPDEGRNVPWHIYNIEACDNAKQTLIGLDGLM
EMVELKKDGPLRDMARDIKERACLFMEEIIQVGGYFQAVQEGFFVDSARYPERNGDGIAR
KIEGGVGYGFIFERAEDYMAPVTAHFGYNNVEQYGGDPENPSALIGGCTFEDRSKIVFID
ELDETDCVDVRIANVKKYLDGKALKPEVEWCADGTILLTMCIPANTRVAEAAALEIGTKL
GLESPEVISKEVLQEAEGTRIEMKGKVTFDVDPSKLVIPPEPHYLSDEVLYKEFGDHPMK
VVCGTVGEDEHSVGLREIINIKHGGIEKWGIQVEYLGTSVPVEKLVDAAVELNADAILAS
TIISHDNVHYKNMKRINELAIEKGIRDKVIIAAGGTQVVPEEARKTGIDEGFGRDSHGID
VATFLAEEAMRRRGDL
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgacagaattaaaacataatgaaaaattagatgttcaaaacatcttgaaggaccttgat
aagtatgaaccgagaagaagaggctggcactggagaacccctgctcccggaatcaaaatg
ggaccttttgaatatcatgattgctcagagcctttaaagaacagtgtaggacttcctcct
gcaaaattcttcggagacatcgatccgcagccgctgcctgttattacaacagaaatcgcc
tccggaagatttgaagatgatattcgaagaatgagaatggctgcatggcatggcgcagat
catatcatggttatcagacatatgggtcagtctcatatcgacggattgatggaaggtact
ccacagggtatcggcggtgttcctatcacaagaaaacaggtcagagcacagagaaaggct
cttgatctgatcgaggatgaggttggccgtccaatcaattaccattcttatgtatccggc
gttgcaggtccggacgtagcggttatgtttgcagaagaaggaatcaacggggctcaccag
gatcctcagtacaatgtactttacagagatatcaactgcgtacgatccttcgttgatgcc
tgtgaatccaagaaggttatggcctgggctgaaatgcttcagatcgatggcgcacacaat
gccaacgcaacggcaagagaggcctggaaggtaatgcctgagctgatcgtacagcacgca
attaacgctttattctcagaaaaggttggtatcaagcctgaactgatcagcttatcaaca
gtaccgcctactgcaactcctgctccttgcgtatatatggatctgccatatgcagtagca
ctgagagacatctgcggcagatataaaatgagagcacagcagaacaccaagtatatctgt
tcttccacaagagaagcaacggtgacccacgttctgaacatgctgatctccaagctgacc
agtgcagatattcagtctacgattacgccggatgaaggaagaaacgttccttggcatatc
tacaacatcgaagcctgcgacaatgcaaagcagaccttgatcggtctggacggcttgatg
gaaatggttgaattaaagaaggacggtccgttaagagacatggccagagacattaaggaa
agagcctgcctgttcatggaagaaatcattcaggttggcggatattttcaggcagtacag
gaaggtttcttcgttgattctgccagatatcctgaaagaaacggcgacggtattgcaaga
aagatcgaaggcggcgtaggctatggctttatctttgagagagcagaagactacatggct
ccggtaacggctcactttggttataacaacgtggagcagtacggcggagatcctgagaat
ccgtctgctttgatcggcggctgtacctttgaagacagaagcaagatcgtattcatcgac
gagctggatgaaacagactgcgttgatgtaagaattgccaatgtgaagaaatatctggac
ggcaaagcactgaaaccggaagtagaatggtgcgcagacggcacgattctcctgaccatg
tgcattccggccaataccagggtagcagaagcagctgctcttgaaatcggtaccaaactc
ggactggagagcccagaagtaatcagtaaggaagttcttcaggaagcagagggtacgaga
attgaaatgaagggtaaagttacctttgacgtagatccttccaaactggtcattccgcct
gaaccgcattatctgagcgatgaagttctttacaaagagttcggcgatcatccgatgaag
gtggtctgcggtacagtgggagaagacgaacactccgtaggacttcgtgaaatcatcaat
attaagcatggcggtattgaaaaatggggcattcaggtagaataccttggaacctccgtt
ccggtagaaaagctggtggatgcagccgtagagctaaatgcagatgcaatccttgcttct
acgattatttcacacgacaatgtccactacaagaatatgaagagaatcaatgagctggct
atcgaaaagggcatccgtgataaagtgatcattgctgccggcggtacacaggttgttccg
gaagaagctcgaaagacaggaattgatgaaggttttggaagagattcccacggtatagat
gttgctacttttttagcagaagaagcaatgagacgcagaggcgatctgtaa

DBGET integrated database retrieval system