KEGG   Acropora millepora: 114946847Help
Entry
114946847         CDS       T06134                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
amil  Acropora millepora
Pathway
amil00010  Glycolysis / Gluconeogenesis
amil00053  Ascorbate and aldarate metabolism
amil00071  Fatty acid degradation
amil00280  Valine, leucine and isoleucine degradation
amil00310  Lysine degradation
amil00330  Arginine and proline metabolism
amil00340  Histidine metabolism
amil00380  Tryptophan metabolism
amil00410  beta-Alanine metabolism
amil00561  Glycerolipid metabolism
amil00620  Pyruvate metabolism
amil01100  Metabolic pathways
Module
amil_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:amil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    114946847
   00053 Ascorbate and aldarate metabolism
    114946847
   00620 Pyruvate metabolism
    114946847
  09103 Lipid metabolism
   00071 Fatty acid degradation
    114946847
   00561 Glycerolipid metabolism
    114946847
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    114946847
   00310 Lysine degradation
    114946847
   00330 Arginine and proline metabolism
    114946847
   00340 Histidine metabolism
    114946847
   00380 Tryptophan metabolism
    114946847
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    114946847
Enzymes [BR:amil01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     114946847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 114946847
NCBI-ProteinID: XP_029179321
Position
Unknown
AA seq 526 aa AA seqDB search
MAFRFASRCLSRGILTRFSPASAVKKGNLATLAEMKIDDSPEIKYNQVFINNNFVDSVSG
KTFPTVNPATGEKICDVAEGDKADVDIAVKAAKEAFKFGSPWRTIDASERGRLLYKLADL
MERDKAYLASLETLDNGKPFSDSFEIDATLAIKCYRYFAGWADKIHGKTIPVDGSYLCYT
RHEPVGIVGQVIPWNFPLVMQAWKLGPALATGNVVVMKPAEQTPLTALYVASLTAEAGFP
PGVVNLVPGYGPTAGMAIAEHMEVDKIAFTGSTEVGHLIQQASGRSNLKNTTLELGGKSP
NIVFADSDLDHAVSNSHFALFFNQGQCCCAGSRCFVEEPIYDEFVARTVEIAKNRVVGNP
FDLKTDQGPQVDGTQLAKILDLIESGNKEGANLLYGGAKHGDKGFFVQPTVFSDVQDDMR
IAKEEIFGPVMQIMKFKDMDDLIERANNTIYGLAASVFSSNIDKINMVASAVRAGVVWVN
CYDVLDAQAPFGGFKESGIGRELGEYGIQQYSEVKTVTIKLPQKNS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcgttttgcttcacggtgtctttctcgcggaattctgacaaggttttctccg
gcttctgccgtcaagaagggtaatcttgctactttggcagagatgaagattgatgatagc
ccagaaatcaaatataaccaggtttttatcaacaacaattttgttgactctgtcagtggc
aagactttccctacagttaacccagcaacaggagagaagatatgtgatgtcgctgagggt
gacaaggctgatgttgatattgctgtcaaggcagctaaggaggcatttaaatttggcagt
ccttggagaacaatagatgcttctgagcgtgggaggctgttgtacaaactggcagatttg
atggagcgtgacaaggcttatctagctagcttggagacattggataatggcaagccattt
agtgattcgtttgagattgatgcaaccttggcaattaaatgttaccgttactttgctgga
tgggctgacaagatacatggcaagacaataccagttgatggcagttacttgtgctataca
cgtcatgaaccagtaggaattgttgggcaggttattccctggaacttcccactggtgatg
caagcttggaaacttggacctgctcttgctacagggaatgtagttgtaatgaagcctgct
gaacaaactcctctcactgctttgtatgtggcatcgctcactgctgaggctggttttccg
ccaggtgttgtgaatctagtccctggttatggacccacagcaggaatggcaattgcagag
cacatggaagttgacaaaattgcctttacaggatcaactgaggttggccatctgattcaa
caagcatctggaagatccaatctgaagaataccactcttgaactgggtggcaaaagccca
aacatcgtgtttgctgattccgatctagatcatgccgtgagtaatagccatttcgcgctt
ttcttcaaccagggccaatgttgctgtgcaggaagtcgctgctttgtcgaggagccaatt
tatgacgaatttgtggcgaggacggtagagattgccaagaatcgagttgttggtaatccg
tttgatctcaagactgaccaaggaccccaggtggacgggacgcagttggccaagatattg
gatttgattgaaagcgggaacaaagaaggggctaatcttttgtacggaggagcaaagcat
ggtgacaaaggcttctttgttcaaccgaccgttttctcagatgttcaggacgacatgcga
attgcaaaagaggagattttcggccccgtgatgcaaatcatgaaattcaaggacatggac
gatttgattgagagagctaacaacaccatatatggcttggcagcatctgtcttttccagc
aatatcgataagatcaacatggttgcatctgctgttagagcaggtgttgtgtgggtgaac
tgttacgatgttctggatgctcaagctccgttcgggggtttcaaagaatctggaattgga
agagaactgggtgaatatgggattcagcagtactctgaagtgaaaacggttacaatcaag
ctaccacaaaagaactcttaa

DBGET integrated database retrieval system