KEGG   Acropora millepora: 114949844Help
Entry
114949844         CDS       T06134                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
amil  Acropora millepora
Pathway
amil00020  Citrate cycle (TCA cycle)
amil00640  Propanoate metabolism
amil01100  Metabolic pathways
amil01200  Carbon metabolism
Module
amil_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amil_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    114949844
   00640 Propanoate metabolism
    114949844
Enzymes [BR:amil01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     114949844
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     114949844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 114949844
NCBI-ProteinID: XP_029181984
Position
Unknown
AA seq 192 aa AA seqDB search
MIGKNTKLICQGYTGKQGTFHSEQSIAYGTQMVGGVSPGKGGQTHLGLPVFDSVKEAKDA
TGADATVVYVPPPFAAAAILEAIDAEIGLIVCITEGIPQQDMVKIKHTLERQDKSRMVGP
NCPGIIKPGQCKIGIMPGHIHKPGKIGLLNQKQGFWNFVFFFVFFSHQIMCYFSGELCTK
NPKLYELHNIFK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgattgggaaaaacaccaaactgatttgtcaaggttacactggaaaacagggaacattt
catagtgaacagtcaattgcatatggaacacagatggttgggggcgtgtccccagggaag
ggagggcaaacacacttagggcttcctgtgtttgatagtgtgaaagaggctaaagatgct
actggggcagatgccactgtggtttatgtgccaccaccatttgcagcggcagccatctta
gaagctattgatgcagaaattggtttaattgtttgcattactgagggaattcctcaacag
gatatggtgaaaatcaaacacactttagagcgacaagacaaaagtcgaatggttggccca
aattgtcctggaataatcaagcctggacagtgtaaaattggtattatgcctggacacata
cacaaaccaggaaaaataggtttgttgaaccagaagcagggcttctggaattttgtgttt
ttttttgtttttttttctcatcaaatcatgtgctatttttctggcgaattatgcaccaaa
aatcccaaattatacgaattgcacaatatttttaagtga

DBGET integrated database retrieval system