KEGG   Acropora millepora: 114953086Help
Entry
114953086         CDS       T06134                                 

Definition
(RefSeq) protein IWS1 homolog A-like
  KO
K17498  transcription factor SPN1
Organism
amil  Acropora millepora
Brite
KEGG Orthology (KO) [BR:amil00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:amil03021]
    114953086
Transcription machinery [BR:amil03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     114953086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 114953086
NCBI-ProteinID: XP_029185074
Position
Unknown
AA seq 394 aa AA seqDB search
MLLTYSSEPDEEAGEQLIVDIFGASDEEEEFVGFGQEDIEVTKKKKGARDKKQQSASVGS
EVDDEEAKSSQDNNLEKMTVPKPTSNKGGDSVDDDDDEMDDRSVFVSDFDLMIQKKKEMN
RTLRRKRKNVDIINDSDDAIARMISQMKDAAEEDRLLNGAKQAATKKLQMLPNILKHLHK
AGLQMTFLDLGVLNVLKDWFNPLPDNSLPHLQIREGLLKVLAEFPPMDARALKMSGIGKA
VMYLCQHPKETRENKKIAGKLINDWARPIFGVTSNFKSLSREEREELDYQNMTKKRRLSS
VNSEGGKTLLLSLNYEVCFSHTYPQPSTWRNYCARHVAILLIVTVFHSLTTTLITSFNYS
TYFTPLPLDLYLTVILRGRAGYEPIHTAYGLVGY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgttattaacttacagctcagaacctgatgaagaggctggtgaacagcttatcgttgac
atttttggagctagtgatgaggaagaagagtttgtggggtttggacaagaagatatagaa
gtgaccaaaaagaagaaaggagctcgtgacaagaaacagcaatctgcatctgttggttca
gaggtggatgatgaagaggcaaagagttctcaagacaataacttagaaaaaatgacagta
ccaaaacccacaagcaataaaggaggagacagtgttgatgatgatgatgatgaaatggat
gatagatctgtttttgtatctgactttgaccttatgatccaaaagaagaaggagatgaac
agaactttaagaagaaaacgaaagaatgtggacatcatcaatgacagtgatgatgctata
gcgcgaatgatctcacagatgaaagacgcagcagaggaggacagattgctgaatggtgca
aagcaagctgcaaccaaaaaacttcaaatgcttccaaatattttgaaacacttgcacaag
gctggtttacaaatgacatttcttgatcttggagttttaaatgttttgaaggactggttt
aatccgttgccagataactcactgcctcacctacagattcgagaaggtttacttaaagtt
ttggctgagtttcctccaatggatgctcgagcacttaaaatgagtggcataggtaaagct
gtgatgtacttgtgtcaacatccaaaggagacgagagagaacaagaaaatagctggaaaa
cttatcaatgactgggcacggccaatattcggtgtcacgtcaaacttcaagtcacttagt
cgcgaggagcgagaagagctcgattaccaaaatatgaccaaaaaaagacgattgagttct
gttaacagtgaaggtggaaagactctgctcttaagtctaaattacgaagtctgtttctct
cacacctatcctcagccgagcacttggaggaactactgtgctcgacatgtcgctatttta
ttaattgtcactgtttttcatagtcttaccacaacccttattacgtcttttaattatagt
acatattttactcctcttcctcttgatttatatttaacagttattcttcgaggacgcgcc
ggatatgagccgatacatacggcctacggcctcgttggttat

DBGET integrated database retrieval system