KEGG   Acropora millepora: 114957377Help
Entry
114957377         CDS       T06134                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
amil  Acropora millepora
Pathway
amil00071  Fatty acid degradation
amil01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amil00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    114957377
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:amil03029]
    114957377
Enzymes [BR:amil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     114957377
Mitochondrial biogenesis [BR:amil03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    114957377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Aminoglyc_resit
Motif
Other DBs
NCBI-GeneID: 114957377
NCBI-ProteinID: XP_029190616
Position
Unknown
AA seq 836 aa AA seqDB search
MEIEPVNQNMTLQECYKGNDEFHSNVKSALNCNGFYAGIMAEARAAVTRPDVRLHVEGTS
ATEAEVELLKSTFTTLKKCAFRTRQQIANGLWPTTWSNLLGVVVAIGALLYSTDFYKLSS
LQPFATVLWKLTYLLHLDEAYPYNVRLVIVSTLAGVVFFIVLLYLRQYTLRMLLAYRGWM
YEPPRSQSMLTLLWGLMVKICSGQHPKLYSYQNSLPRMSVPSLSNTCKELLNSVKPILDD
KEFKKMEELAKDFEKNLGPKLQFILKLKSWWAPNYHTDWWEKYVYLMGRSPLPINSNYYC
LDQNWHPTLNQASRAATITYFCLKYYQEIRSETLEPLHIRKTIPICMWQYERTFKTTRIP
KEDVDELVHFEPTENEHIIVFCGGNIYILPVTNSKGKYLSTLDLEGQFEWIQADVKHSGA
MKDQPESSVPALTALPRKEWASIRKEYFSEGLNRQALEAIEEALFVVVLEDKSFTDLSER
AKYLLHADGRSIWFDKSFCLMVFSDGKCGVNAEHSWADAPVLGHMLEYAVTYEFIYRTYN
DKGKCSPIGGAHRSAHLRTHNLQKPARLYWDMTPKLTEIVENAVKFSQKNNDDTQHYVLV
HDAFGKGFIKQMKVSPDAFIQLALQVAYYRDSGGRHPLTYESSMTRLYLQGRTETVRSFT
MEAKEFVLAFENKAVSIETKYELFLKAANLHAKKYKDCMNGMGIDRHLFALYIVCKGQGF
ESEFLKSALSLPWTLSTSQQPQQQMSSQYFSVTEPELRHQISPGGGFGPVADNGYGVSYM
VPDDNQIFFHISSKISAKETDSNRFFKHLFESMSEIKDLYEAIKGKKAQVPSNASS
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgaaccggtgaatcaaaatatgacattgcaggaatgctataaaggaaatgat
gaattccattcaaatgtgaagagtgcgttaaattgtaacggattttatgccggcatcatg
gcagaagccagggcggctgttacgaggcccgatgtccgtcttcacgttgaaggaacaagt
gcgactgaagccgaagttgaattacttaaaagcactttcacaactctaaaaaagtgtgct
ttcagaacccgtcaacagattgccaatggattatggccaacaacttggtccaacttatta
ggtgtggtagttgccattggtgccttgctttattccaccgatttctataaactgtcttcg
ctgcagccctttgcaactgttttgtggaagctcacatacttacttcatctggacgaagca
tatccttacaatgtccggcttgttattgtatcaactttggctggtgtggtgttctttatt
gtgcttctatatttaagacagtacacactgaggatgcttctggcctatcgtgggtggatg
tatgagcctcctagatctcagagtatgctgacattgttgtggggattgatggtcaagatt
tgttctggtcagcacccaaagttatacagttatcagaatagtcttccaaggatgtctgtc
ccaagcctaagtaatacctgtaaggaattattgaattctgtcaaaccaatcttagatgat
aaggagttcaagaagatggaagagcttgctaaggactttgagaaaaaccttggcccaaaa
cttcagttcatcttgaagctcaaatcatggtgggcacctaattatcacacagactggtgg
gaaaaatatgtgtacctcatgggtcgttcaccactacctatcaatagtaactactattgt
ctcgatcagaactggcaccctacactaaatcaagcctcaagagcagctaccataacctac
ttctgtttgaagtattatcaagagataaggtcagagactctggaacctctgcatatcaga
aaaaccattccaatttgcatgtggcagtatgaaagaacttttaagaccacaaggattcca
aaggaagatgtggatgaacttgtacactttgaaccaacagaaaatgagcatataattgtg
ttttgtggaggcaacatttacattcttccagtgaccaacagcaaaggaaaatatttatca
actttggatctagagggtcagtttgaatggatccaggcagatgtcaagcactctggagct
atgaaagatcagcctgaaagtagtgtaccagccctgacagcattgcccagaaaagaatgg
gcttccattaggaaggagtacttctcggaggggcttaatcggcaagctcttgaagccatt
gaggaggccttgtttgtggtcgttttagaagataaatcttttacagacttgtctgaacgt
gccaagtatctattgcatgccgatgggcgcagcatttggtttgacaagagtttttgcctt
atggttttttctgatggcaaatgtggagttaatgctgaacattcatgggctgatgcacct
gttttggggcatatgctggagtatgctgttacttatgagttcatttacaggacatacaat
gataaaggtaaatgctctcccattggcggtgcacacaggagtgctcatttgaggacccac
aaccttcaaaaaccagccagattgtactgggatatgactccgaaactaacagaaattgtg
gaaaatgctgtcaaattttcacaaaagaataatgacgacacccaacattatgtgttggtt
catgatgcatttgggaaaggattcataaagcaaatgaaggtcagccctgatgcatttatc
caattggccttacaagtggcttactacagagattctggaggaagacatcccctcacttat
gagtcttctatgacacgcctttaccttcaaggcaggacagaaaccgtgcggagctttact
atggaagctaaagaatttgtgttggcgtttgaaaacaaagcagtttccattgaaacaaaa
tatgaactttttctcaaagctgctaatcttcatgcaaagaaatacaaggactgtatgaat
ggaatgggaattgacaggcatctttttgccttgtatatagtttgcaagggtcagggattt
gaaagtgaatttctaaagagtgccttgagtctgccatggacactatcaacaagccaacaa
ccacagcaacagatgagtagccaatacttcagtgttacagaaccagaactcaggcatcaa
atttctcccggtggtggttttggacctgtggctgataatggctatggtgtttcctacatg
gtcccagatgataatcaaattttcttccatatttcttcaaagatctctgccaaagagaca
gactctaacagatttttcaagcacttatttgaaagcatgtctgagattaaagacctatat
gaagccattaaagggaaaaaggctcaagtgccaagcaatgcaagttcttaa

DBGET integrated database retrieval system