KEGG   Acropora millepora: 114957610Help
Entry
114957610         CDS       T06134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
amil  Acropora millepora
Pathway
amil00260  Glycine, serine and threonine metabolism
amil01100  Metabolic pathways
amil01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amil00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    114957610
Enzymes [BR:amil01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     114957610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP IF2_N
Motif
Other DBs
NCBI-GeneID: 114957610
NCBI-ProteinID: XP_029190928
Position
Unknown
AA seq 426 aa AA seqDB search
MAKALSAASHILWCTRLKCVSSSTTRAFRSLRPMKDRDGEEKGIANQVRHFSSMYISGLF
DRMQNDGLRVIDLRSDTVTKPTREMRDAMAVAQSGDDVYGDDPTVNALQIKAAELTGKEA
ALFVASGTMGNLISVMAHCRGRGEEILVGDQSHIIIWEQGGVAQVAGVHPRQVQTNCDGT
LDLADIANKVRSPCDTHQPVSRLICVEQTHNATGGRVLSLDYLQKVRKLATELGLKVHMD
GARIFNAATALGVPVAHITQHVDSISFCLSKGLGAPVGSVVAGEEDFIARCLRHRKVLGG
GMRQAGVLAAAGIYALDHIAPKLHQDHTNAQILAQGIQEMKNLGIEIDMETIDTNMVYFK
VNNNKVSANDLVKSMFTVSDTDPMEKQVAVKMLTLGKNRIRLVLHHQVTEADIQKTLEKI
RMILTS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggcactgagcgctgcctcacacattttatggtgtacgcggttaaaatgtgtt
tcatcttcaacgacaagggctttccgcagcctccgcccgatgaaagatcgcgacggagag
gaaaaagggatcgcaaatcaagtgagacatttctcaagcatgtacataagtgggttattt
gatcgaatgcaaaatgacggtcttcgtgtgatcgatttaagaagtgatacggttactaaa
cccacaagagaaatgagagatgcaatggccgttgctcagtcnggtgacgatgtttatgga
gatgatccgacagtaaatgccctacagatcaaagcagcagaattgacaggaaaagaggca
gccctttttgtggccagtggaacaatgggaaatttaatatcagtgatggcacactgcaga
ggacgaggagaagaaatacttgttggagaccagtctcacattattatttgggaacaaggt
ggagtggcacaggtggcaggggtgcaccctcggcaagtgcaaaccaactgtgatggaaca
cttgatttggcagacattgccaataaagtgcgctcaccttgtgatactcaccaacctgta
agtcgcttaatttgtgtggaacaaactcacaatgcaactggaggtagggtgctgtcactg
gactacttacaaaaggtgagaaaactggctactgagcttggattaaaggttcacatggat
ggagcaagaatctttaatgcagctacagctctaggtgtgcctgtggcacacattactcag
catgttgattccatttctttctgtctttcaaagggccttggtgctcctgtgggttctgta
gttgcaggagaggaagacttcattgcaaggtgtttgagacataggaaagttcttggggga
ggtatgcgacaggctggggtgttagctgcagcagggatatatgctttggaccacatagcc
cctaaactgcaccaagatcacacaaatgcacaaattctggctcaaggaattcaagagatg
aaaaatcttggcattgagatagacatggaaacaattgataccaacatggtttacttcaaa
gttaacaataacaaagtgtctgccaatgatctagtaaagagcatgtttacagtctctgat
actgatccaatggagaaacaagtggccgtgaaaatgttgacacttgggaagaacagaata
aggcttgttcttcaccaccaggtgacagaagctgacattcaaaaaactttggaaaaaata
aggatgatattaacatcataa

DBGET integrated database retrieval system