KEGG   Acropora millepora: 114962105
Entry
114962105         CDS       T06134                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53-like isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
amil  Acropora millepora
Brite
KEGG Orthology (KO) [BR:amil00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:amil03036]
    114962105
Chromosome and associated proteins [BR:amil03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    114962105
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5
Other DBs
NCBI-GeneID: 114962105
NCBI-ProteinID: XP_029196875
Position
Unknown
AA seq 360 aa
MAMQNGYTVVTDLRSKPGVTVQRRRRKQSVKIERNIDEDALMASAIGDVTWLQQSLYDTR
KVYSVSKEHGLAPIHLAAQNGQLECLRTMIEKYKVDVNFQSASGWTPLHLAINKSTKKSG
VKCVKFLLENGADPSMQTNTGITPVHQAASEGHVKCLQELIKWGAKIDAIDINGHTPIFI
ARVCAHRVCARILANQLWYLNKQRYLVDRLEKEQQTKRLEEERHKLSLIRIAEGKHESKL
AFEQWLGNKGIPDIVTMYGPIPSEERKGVSEVRSSQSVRPSPAPVVAETAIVVRSKTEFE
SLDASPTFASRKSLEHDHDNDKKLDLIPLERISASKLRKGQRTEGLRRNKPRMTKNSSMV
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcgatgcaaaatgggtatacggtagtgactgatctaagatcaaaaccaggcgtcaca
gtgcagcgacggagacgaaagcaatccgtaaaaatagagagaaatatagacgaagatgca
cttatggcttcagctattggggatgtgacatggctacagcaaagtctctacgacacgcga
aaagtttactccgtttctaaagaacatggcctggcaccaatccaccttgcagcacagaat
gggcagcttgaatgcctcagaacaatgattgagaaatacaaagtagatgtgaattttcaa
agtgcctctggctggacacctcttcacttagcaatcaacaaatcaacaaagaagagtggg
gtgaaatgtgtgaaatttctgttggaaaatggtgcagatccttcaatgcaaacaaataca
ggaataactccagtccaccaagcagcaagtgaagggcatgtgaagtgcctacaggagctt
ataaaatggggcgccaaaatagatgccatcgacattaacgggcacactcctatttttata
gcccgtgtgtgtgctcacagagtatgcgcgcggatattggccaaccagctatggtattta
aacaaacagagatatttggttgacagacttgaaaaggaacagcaaactaaacgacttgag
gaagaaaggcacaaattaagcttgattcgcattgcagagggtaaacacgaaagtaaactc
gcttttgaacagtggttaggaaataaagggatcccggatattgttacaatgtacggtccc
atcccctctgaggaaagaaaaggcgtcagtgaggtccgctcttcgcagtctgtccgcccc
tctcccgccccagtagtagcagaaacggcaattgtcgtccgttccaagactgaatttgaa
tctttagatgcatcgcctacctttgcttctcggaaatccttggaacatgatcacgataat
gataaaaaactggatttaatcccactggagagaatttccgcttcgaaacttaggaaagga
caaaggaccgaagggctaagacgtaacaagccacgaatgaccaaaaattcgtctatggtt
tga

DBGET integrated database retrieval system