KEGG   Acropora millepora: 114962677Help
Entry
114962677         CDS       T06134                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
amil  Acropora millepora
Brite
KEGG Orthology (KO) [BR:amil00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amil04131]
    114962677
Membrane trafficking [BR:amil04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    114962677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 114962677
NCBI-ProteinID: XP_029197548
Position
Unknown
AA seq 2119 aa AA seqDB search
METVKMAAQSSGGSQSSGSTRAFAQKLSKFRRNGSSSSGTLSGLTKSPSTSSSFLHFATG
TIPLNEVVEPPDFEDIVLAHQPFNENDPNSKMLEFPDDDLEVTTINRQCRTVQPCFPSDS
GIENNPQLKDCIHCYSADWAIVNRRYQFRCSDEGKPDSRRKIVRSPSFVKSLPVQVYEID
EKGKLSEQGKSASQLKLNQGKEKDDSLPRGSWASSIFDLQSCSPDPLLPSVLERTPAEEV
DLANEEDRGLFRIHSLFSIYSVQQEEGIERRVPATIPQEHFGQRILVKCLQLKLELEVEP
IFASMALYDGKVKKKISENFYFDMNSEWCRKLVKDHSSRMDISTLSRSGIFSITYPSSDV
FLVIKLEKVLQQGDIGECAEPYMKDTENPKHRDKMRAAAVANCDRLGKYRMPFAWTAIHL
VDIITGKSTTTDVGSVQEKDVAVTPLSSRKQSSMSDTQTASVRSSRSSMYESRKSVNLAD
VAEYEVVPDLTNFRPVTLTVSSFFKQETDKLKDDDLYKFLADLKRPSSVLKRLKCIPGTL
KLDISPPGDKPPYCLTSELHQLNPYPDGQGRPTKEIEEFAPKEVFAPFLTYKNLLYVYPL
SVNYTSRSSSARNIAVKVEFLAGEDVAPLECLFGKSSTSAMQSEAWSAVTYHNKAPDFYE
EVKVKLPAHLTVEHHLLFTFYHISCSAGKKADDKVPTETPIGYTWIPAVKEGRLSLGEFH
LPVSLEKPPPSYSMLSPEVPLPGMKWLEGHKGVFHVAVRAVSSIHPQDLHIQKFLKTCHQ
IEGRVTSSPNRTAEGNLESALRKSIVDLCKAREEPLVRFLYLVLDKLILLLVRPPIISGT
VVNIGQAAFESLTQIVDRLHQLLENSQDEHGRNQLLSSYITYVFSAPYSYSPTSSPDHRS
GHREPGRSASIPVGLQSKSRQKLSSSNPQLNATLTDEKPELLGCWEDDGEEITCEGMNMP
GNRSSMAEGRSNTLGAPRMSQSTSTNSRKLVHEELGLQWAVASGPLKEKAMAHAWFFFEL
MVKSMAQHLENTDKFFWTRKSRFPEQFLGDIRAMVNSTVYEIATKIEDFVLAERLNSSLA
FFLFDLFSLIDRGFVFELVKQYCKEMLYQSTIVPEASQLRLEFLRIVCSHEHYVTLNLPF
PSPLYPSPPISPTNSVSSIASSASAYTVIIGNSVAELSTAFRQQHFLAGLVLSELALALE
GGEMTLINQAIDTTRDLIAGHDSDTRYDEVPCRSAVAALYLPIVGLVIGALQQLHGYGSE
ENSSITPDVAMAIATSSIMGGLAVEENKGDLSSQKSKPQQFSPETTRNLLVCFLWVLKNV
DSQVLKDWWSDQPASRLGLLLDVLRLCVSLFEYSGKVQKSSQNPTAPRPKAQQEMKAKLE
EMMLGNKGAAKEMMQRHSRVMLEKGQSPSSESRLRWRKDQTQWRQAADQLDRLRPEAEVT
SQIEGSLAAEVSSIVLDSLEHLVQTVTTSDSLRVVLSGILRVLLHCLNCNQSEIVLQNMF
ATQRSIVYKFPELLFEDDTELCADLCSRLLNHCSSAISSIRAQASSSLYLLMRQNFEIGN
NFARVKMQVTMSLSTLVGTSHTFNEDHLRRSLKTIIIYAESDQELKTSTFPDQVRELVFN
LHMILSDTVKMKEYQEDPEMLIDLMYRIAKGYQNSPDLRLTWLYNMAAKHGELNNHVEAA
MCLVHTAGLVSEYLSMLEDKPELPIGCVSFEKISPNVLEESAISDDVVSPDEEGICTGKY
FSENGLVSLLEMAANRFTLAQLFECVNEVYKLLIPILEARRDYKKLTAVHKKLSEAFAKI
IQTEGKRMLGTYFRVGFYGSKFGDLDGEEYIYKEPAITKLPEVSHRLQAFYGAKFGADVV
EVIKDSNAVEQDKLDPEKAYIQLTYVDPYFDEYELKDRITYFDKNFNLRRFKYDTPFTPS
GKAHGELVTQYKRKTILTTANSFPYVKTRINVVHREQIVLSPIEVAIEDMEVRTKDLVNA
VQQEPPDAKMLQMVLQGSIGATVNQGPLEIALVFLCQGQESNEEGESQMFTRHHHRLRLS
FKEFVKRCGDALQKNKHLIQLDQRAYQKELERNYTKLTEKLEPLLKNKFGSLRGSMRQKE
GSALLRKISMSFSAGHSVA
NT seq 6360 nt NT seq  +upstreamnt  +downstreamnt
atggagacagtcaaaatggccgcccagagttcaggcggtagccaaagttcaggttctacg
agagcttttgcccaaaaactcagcaaattccggcgaaatggctcaagctcttctggaacc
ctgtcaggcctcactaagtcaccttcgacatcaagttcgttccttcattttgctacggga
acgattccactcaatgaagtggttgagccaccagattttgaagatatcgtattagcacac
caaccatttaatgaaaatgatcccaacagtaaaatgctggagtttcccgatgacgactta
gaggtgaccacaatcaacagacaatgtcgcacagtccagccatgttttcctagtgatagt
ggaattgaaaacaatccccagctgaaagactgtatccactgttactctgccgactgggcc
attgttaatcgcagataccaattccgttgttctgatgaaggcaaaccagactcaagacgc
aaaatagtgcgatcacctagttttgtgaaatcacttcctgttcaagtttatgaaatagat
gaaaagggaaagctctcagagcagggcaaaagtgcatcccaattaaaattaaaccaagga
aaggagaaggatgacagcttacccaggggaagctgggcatccagcatttttgatctgcag
tcctgcagcccagaccctctattgccatctgttcttgagcggaccccagcagaagaagtg
gaccttgccaatgaagaggaccgcgggttgttcaggatccattctcttttttctatttat
tctgtccaacaggaagagggaatagagaggagagtcccagcaactattcctcaggagcat
tttggccagaggattttagtcaaatgtctgcaactcaagttagagttggaagtggaacca
atttttgcttctatggccctgtatgatggaaaagtcaagaaaaagatatcagagaacttc
tactttgacatgaacagtgagtggtgtagaaaactggtgaaagaccacagttcacgcatg
gatatctcaacactaagccgttctggaatattttcaatcacatacccatcttccgatgtt
ttcctggtcattaaactggaaaaggtgctccaacaaggggatattggcgaatgtgctgaa
ccatacatgaaagacactgaaaacccaaagcatcgagacaagatgcgtgctgcagctgtg
gcaaactgtgacaggcttgggaaatatcgcatgccatttgcatggactgcaatacatctg
gtggacataatcacagggaagagtaccacgacagatgtgggatctgtgcaagagaaagac
gttgcagtaactcctttatcaagcagaaagcaatctagtatgtcagacacacaaacagca
tcggtccggtctagtcgaagctctatgtatgagtcacggaagtcagtaaacctcgctgat
gtagctgagtatgaagttgttcctgatttaacaaacttcagacctgtgactctcacagtc
agcagtttcttcaaacaggaaactgacaagctgaaagatgatgatttgtacaaattctta
gctgatctgaaacgaccatcgtcagtattaaaacgtctcaagtgtattccaggaaccctt
aagcttgacatttcacctcctggagacaaacctccatattgcttgacatcagaattgcac
cagttaaacccttacccagatggtcaggggagaccaaccaaagaaattgaggaatttgca
cccaaagaagtctttgcacccttcctcacttacaagaatttgttgtatgtgtatcctttg
agtgtcaattacactagtcgcagttcgtctgccaggaatattgcagtgaaagtagagttt
cttgctggagaagatgtggcaccactcgagtgtttgtttggcaagtcaagcacctcagca
atgcaatcagaagcttggtcagcagttacgtaccacaacaaggcgccagacttctacgag
gaagtgaaggtcaagttaccagcccacctcacggtcgagcatcacttgcttttcacattt
taccacatcagctgctcagctggcaagaaagcagatgataaagtacccactgaaacacct
attggatacacgtggattcctgctgttaaggaaggtcggctgtctctaggggaatttcat
cttcctgtgtcattggagaaacctcccccaagttacagcatgctctcaccagaggttcct
cttccaggaatgaaatggcttgaaggtcataagggtgtgtttcatgttgctgtgagagct
gtgtcttcgatccatccacaggatttgcatattcaaaaatttctgaagacctgtcatcaa
atcgaggggcgtgtgacgtcatcacccaaccgcaccgctgaagggaacttggaatctgcg
ctgaggaaaagcatagtcgacctgtgcaaggcgcgcgaggaacctttggtgcggttttta
taccttgtattggataaactgattttgctccttgtcaggccgcctattatatctggaact
gtagtgaatattggccaagcagcgtttgaatcgctcacacagattgttgaccggctgcat
cagttactggaaaacagtcaagatgaacatggtcgcaatcagctgttatcgtcttacatc
acatatgttttctccgcgccctacagctactcacctacatcttcaccggatcatcgtagt
ggtcacagagagccgggtcgctcagcgagtatccccgttggcctgcaaagcaaatcccgt
cagaagctgtcaagcagcaatcctcagctgaatgccacgttgaccgatgaaaagccagag
ttacttggatgctgggaagacgatggtgaggagattacatgcgagggcatgaacatgccc
ggcaacagaagcagtatggcagaaggacggtcgaacactcttggtgcccctagaatgagt
caaagtacttccaccaacagcagaaagttagttcatgaagagttggggttacagtgggcc
gtggccagcggtcccctgaaggaaaaagccatggcgcatgcgtggttcttttttgaactt
atggttaagagtatggctcaacatcttgaaaacaccgacaagttcttttggacaagaaaa
agtcgtttcccggaacagtttctgggcgatatacgagccatggtgaactctacagtctat
gaaatcgccacaaagatagaggattttgttctagcggagaggttgaactctagtcttgcc
ttcttcttgtttgaccttttttcattgattgacagaggctttgtgtttgaacttgtcaag
cagtactgcaaagagatgctgtatcaaagcaccattgttcctgaagcatcacaactcaga
ctcgaattcctgcggattgtttgcagccatgaacattacgtaaccctcaacctacccttc
cctagtccattgtatccatccccacccatctccccgacaaattcagtgtcgtccattgcc
tcgtcggcgtccgcttataccgtcatcatcggaaacagtgtagcagagttgtcaaccgca
tttagacagcagcacttcttggctggcttggtgttatctgaactggctttggcattagaa
ggaggtgaaatgaccttgataaaccaagccatcgataccacaagagacctgatagccggt
cacgactcagacacgcgatacgatgaagtgccgtgtcggtctgccgttgctgctctgtat
ctgccgattgttggtcttgttatcggcgcattacagcaactccatggttacggcagcgag
gaaaactccagtatcactccggatgtggcaatggccattgctacatcgagcataatgggt
ggtttggcagttgaggaaaacaagggcgaccttagttcgcagaagagtaaaccacagcag
ttcagcccggagacaactcggaacctgttggtttgtttcctatgggtgctcaagaatgta
gacagccaggtactcaaagattggtggtcggatcagcctgcttcaagactgggtttgctt
ctcgatgtgcttcgtttatgcgtttctctgttcgagtacagcggcaaagttcaaaagtct
tcacagaatcccacggcaccaagaccaaaagcacagcaagagatgaaagctaaacttgag
gagatgatgctcggaaacaaaggagcagccaaggaaatgatgcagcgacatagtagagtg
atgctggagaagggccagtcaccaagctctgagtcgagattaagatggcgaaaagatcaa
acacaatggagacaagctgctgaccagctggacaggctccgccctgaggcagaagtcact
tcccaaattgaaggttcgctggcagctgaagttagttcaattgtgcttgattcactggaa
cacctggttcagactgtgacaacctcggactcgcttcgtgtggttctgagtggaattctg
agggtgctgctgcattgtctcaactgcaatcagagtgagatcgttttgcaaaacatgttt
gctacacagagatctattgtttataagttccccgagttactattcgaagatgacacggag
ctgtgcgcagacctgtgctccaggctccttaatcactgcagctcggccatcagcagtatt
cgggcccaagccagctcatctctctatcttttgatgagacagaattttgaaattggaaac
aactttgctcgagtcaagatgcaagttaccatgtcactctccactctagttggaacttca
cacactttcaatgaagatcatttgcgtcgctcgttaaaaaccatcataatatacgctgaa
tcagaccaggagctcaagacaagcacttttcccgatcaggtcagagaactggtcttcaat
ttgcacatgattttgtcggacacagtcaagatgaaagaataccaagaggatccagaaatg
ttgatagatctaatgtacaggatagctaaaggatatcaaaattcgcctgatctgagatta
acctggctgtacaacatggctgccaagcatggcgagctgaataaccatgttgaagcagcc
atgtgtctggttcataccgcgggccttgtgtctgagtatctgagtatgctggaagacaag
ccagagctgcccattggatgtgtttccttcgagaaaatttccccaaatgttctggaggag
agtgctatttcagatgatgtcgtttcgcctgatgaagaaggcatttgtactggcaagtat
tttagtgaaaatggtttggtctcgctgcttgagatggccgccaacagatttactcttgcg
cagttgtttgaatgcgtcaatgaagtttacaaattgcttataccgatacttgaggccaga
cgcgactacaagaaactaactgccgtacataaaaaactatccgaagcgtttgccaagatt
atacaaacggaaggaaagcgtatgctggggacatattttcgagttggattttatggatct
aagtttggtgatctcgacggtgaagagtacatttacaaagaaccagcgattactaagttg
cctgaggtttcacatcgactccaggctttttatggcgcaaagtttggcgcagacgttgtg
gaagtgatcaaagattccaatgctgtcgaacaggacaaacttgatccagaaaaagcctac
attcagctgacatatgtggatccttactttgatgagtatgaactgaaagaccgtataact
tacttcgacaagaatttcaatttgaggcgatttaagtatgacacaccgttcactccgagt
gggaaagcacatggggagcttgttacgcagtacaagagaaagaccatcctgacaactgcc
aattcatttccttatgttaagacaagaatcaacgttgtacaccgagaacagattgttctc
agtcctattgaagttgctattgaagatatggaagtgcggaccaaagatcttgtgaatgca
gtgcaacaagaaccgcctgatgccaagatgctgcaaatggtattgcaggggtccattggc
gccacagtcaaccagggtccactggagattgcattggtgtttctgtgtcaaggtcaggaa
tctaacgaagagggagaaagtcaaatgttcaccagacatcaccacagactaaggctttca
ttcaaggagtttgtgaaaaggtgtggcgatgcattgcagaagaacaagcacctgattcaa
cttgaccaacgtgcttatcaaaaggaacttgaaagaaattacactaaactaacagaaaaa
cttgaacctctattgaagaacaagtttggatcactgcgcggttcaatgagacaaaaagaa
gggtctgctttactgaggaagatctccatgagtttcagcgctggacacagtgtcgcttag

DBGET integrated database retrieval system