KEGG   Acropora millepora: 114966555Help
Entry
114966555         CDS       T06134                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
amil  Acropora millepora
Pathway
amil03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:amil00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114966555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:amil03041]
    114966555
Enzymes [BR:amil01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     114966555
Spliceosome [BR:amil03041]
 Complex C
  Other components
   Step II factors
    114966555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_19 AAA_22 RSRP T2SSE AAA_30 AAA_14 RsgA_GTPase PhoH DUF2075 AAA_16
Motif
Other DBs
NCBI-GeneID: 114966555
NCBI-ProteinID: XP_029202298
Position
Unknown
AA seq 1176 aa AA seqDB search
MEEINQLEQLSLVSKICTELDNHLGINDKDLAEFIIMLSEKNPTLEKFRAALADNGAEFP
ESFTSNLLRLIQKMKPEKPGTVDIKPGTSVDSEKITSVVSEKRSAFPGLCIPDDIEQENE
RPEEDEQVASTALSELEALMSKAKSSSLESVRERQRSRSRSRSKDRDRQRHRSESRSPNR
DRDRKKYRERWTRREEKSKSRRKDEARDKHHGLTPTEKLPCVTPVVGQIYKGKVTTIMQF
GCFVQLEGLRGRHEGLVHISQLRREGRVANVSDVVHRGERVRVKVLSMPGDKISLSIKDV
DQDTGEDLNPTRLRGDGEMARNPDRPVGIPVVPIFDDDEPSAKRKVQRLSSPEKWEVKQL
ISAGVLDKADHPEFDEETGVLPKDDHSDEDVEIELVDEEPPFLRGQTKLSVSMSPVKIVK
NPDGSLQRAAMTQSALAKERRELKQAHREAQADSIPKDIGKLWIDPVPNADGIKPVFAQD
MRGIGLANDDMPEWKRATFGGNKASYGKKTNLTILEQRQGLPIYKLRQELLKAVLENQVL
IVIGETGSGKTTQITQYLAEEGFLSTGKLACTQPRRVAAMSVAKRVSEEYGCRLGQEVGY
TIRFEDCTSTETKIKYMTDGMLLRECLLDSDLNQYAIVILDEAHERTISTDVLFGLLKKT
VKKRPDLKLIVTSATLDAVKFSTYFFEAPIFTIPGRTFPVEILYTKEAETDYLDASLITV
MQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRI
FDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKSGIDALVVTPISQAQA
KQRSGRAGRTGPGKCYRLYTERAYRDEMLPTAVPEIQRTNLASTILSLKAMGINDLLSFD
FMDPPPMETMISAMEQLHSLSSLDDEGLLTRLGRRMAEFPLEPQLSKMLIQSVHLGCSDE
VLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQSEGDHLTLLAVYNSWKNNKFSNPWCFE
NFVQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKTTSRVQKAITSGFFRNAARKDPQEGY
RTVTDNQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTVDPKWLVEFAPAFFKTG
NPTKLSKRKRQERLEPLYNRYEEPNAWRISRAFRRR
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatcaaccagcttgagcagctatctcttgtttctaagatttgtacggagttg
gataatcacttgggcatcaacgacaaggaccttgctgagttcataataatgctgagtgag
aaaaaccccactttggaaaagtttagagcagctttagcagacaatggtgcagaatttcca
gagtcattcacttccaatctattgagattgattcaaaaaatgaaacctgaaaagccagga
acagttgatattaaaccaggtacatctgtggacagtgaaaaaataacttcagtggtgagt
gagaagcgctctgcattccctgggctctgcattcctgatgatatagaacaggaaaatgag
agaccagaagaggatgaacaagtggcatcaactgctcttagtgagctggaagctcttatg
tccaaggcaaagtcctcctcattggaatctgtcagggaaaggcaaaggtcacggtcaaga
agccgaagtaaagacagagacaggcaaaggcacagatcagagtctagaagcccaaataga
gacagagacaggaaaaagtacagagaaagatggacaagaagggaagagaaatcaaagagt
aggagaaaagatgaagccagagacaaacaccatggccttacacccacagagaaattgcct
tgtgtaactccagttgttggtcagatctacaagggaaaggtgacaacaatcatgcagttt
ggatgctttgttcaattggaaggtttaagaggtcgtcatgaaggcttagtgcacatttcc
cagcttcggcgtgaaggacgagtcgctaatgtgagtgacgttgtacacagaggtgaaagg
gttagggtgaaagttctatcaatgcctggtgacaagatcagtctgagcattaaggacgtg
gatcaagacacaggtgaagacttgaatcccaccagattaaggggagatggtgaaatggca
agaaacccagacagaccagtgggcatcccagtggtacctatttttgatgatgacgagcca
agtgcaaaaagaaaagttcagaggttaagctcaccagaaaaatgggaagtaaagcagcta
atttcagctggtgttttggacaaggccgaccacccagagtttgatgaagagacaggtgtc
cttcccaaagatgatcactctgatgaagatgttgaaattgaattagttgatgaggagcct
ccgtttttacgagggcaaactaaacttagcgtgagcatgagtccagtgaagattgtaaag
aatccagatggctccttgcaaagggctgctatgacccagagtgcattagccaaagaaagg
agagaactcaagcaggcacacagggaggctcaagcagacagcatacctaaagacattggc
aagctctggattgatccagttccaaatgcggatggtatcaaaccagtctttgcacaagac
atgcgaggtatcggattggccaatgacgacatgcctgaatggaaaagagctacatttgga
ggaaacaaagcgtcatatgggaagaaaaccaatttgactattctcgaacaacgacaaggg
ttacccatatacaaactaaggcaagagctattgaaggctgtccttgaaaaccaagttttg
attgttattggagaaacaggcagtggaaagacaacacaaataacccagtacttagcagaa
gaaggtttcctttctaccggcaaacttgcttgcactcaaccccgaagagtagctgcgatg
tctgtagccaagagagtgtcagaagaatatggttgtcgccttgggcaagaggttggctac
acgattcgatttgaagactgtacaagtactgaaaccaaaattaaatacatgactgatgga
atgcttctgagggaatgtctccttgactctgacctcaatcagtacgccattgttatactt
gatgaggcccatgagcgcacaatcagtactgatgttctctttggcttgttgaaaaagact
gtgaagaagcgcccagatttgaagttgattgtgacatcagctacattagatgccgtaaaa
ttctcaacatatttctttgaggctccaatatttacaatccctggcagaacttttccagtc
gagattttgtacacaaaagaagcagaaacagattaccttgatgcttccctcattactgtt
atgcaaatccatttgactgaaccaccaggcgatatcctagtatttttgacaggccaggag
gaaattgacacagcttgtgagatactctatgaacgcatgaagagtctgggccctgatgta
ccagaactaattattttgccagtgtacagtgctctaccatcagagatgcaaaccaggata
tttgatccggctcctccaggcagtcgaaaggttgtgattgctaccaatattgcagaaacg
tcacttactatagatggcatatactatgtagttgaccctggatttgtcaagcagaaagta
tataactcaaagtcaggaattgatgctttggttgtgacaccaatttctcaggctcaagct
aagcaacgctctggtagagcaggtaggacaggacctggtaagtgttatcgcctttacaca
gagcgtgcttacagagatgagatgttgcctactgcagtccccgagattcagcgcacaaac
ctggctagcactatactgtcactcaaagcaatgggcatcaatgaccttttgtcctttgat
tttatggatccaccacctatggagacaatgatttcagctatggaacaactacattctctc
agttccttggatgacgaaggcctactgaccaggttgggaaggagaatggccgaatttcct
ctggagccacaattgtccaagatgttaatccagtctgttcatcttggatgtagtgatgaa
gtattaactatcgtctccatgctgtctgttcaaaacgtcttctacagacctaaggacaaa
caagctcttgctgaccaaaaaaaagctaagttccatcagtctgaaggagaccacttgacc
ttgcttgcagtgtataattcctggaagaacaacaagttctcaaacccttggtgctttgaa
aattttgtgcaggccaggtcgctgagacgagcacaagacatcaggaagcaaatgcttgga
attatggacaggcacaagcttgatgttgtatcatgtggcaagaccacgtcacgcgtgcag
aaggcgataacgagtggtttcttccgcaatgcagcaaggaaagatccacaggaaggttac
cgcacagtaactgataaccaggtggtatacattcacccgtcgagtgcgctgtttaaccga
cagccagaatgggttgtgtatcatgagctagtgcttacaacaaaagagtacatgagggaa
gttaccacagtcgatcctaagtggcttgtggagttcgctcctgcatttttcaagaccgga
aatccaaccaagctgagcaagcgcaagagacaagaaagattggagcctctatataaccgg
tatgaagaacccaatgcttggagaatttcgagagcctttagaagaagataa

DBGET integrated database retrieval system