KEGG   Acropora millepora: 114974167Help
Entry
114974167         CDS       T06134                                 

Definition
(RefSeq) nucleolar protein 58-like
  KO
K14565  nucleolar protein 58
Organism
amil  Acropora millepora
Pathway
amil03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:amil00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    114974167
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:amil03009]
    114974167
Ribosome biogenesis [BR:amil03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    114974167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 114974167
NCBI-ProteinID: XP_029210312
Position
Unknown
AA seq 533 aa AA seqDB search
MLVLFETPAGYAVFKLLDEKKLQQIDNLYKDFETPDAASKVVKLKHFEKFNDTTQALAAA
TATVEGKMSKSLKKVLKKIVAKDIHQELAVADAKLGGVIKEKFSLSCVTSSAVQELMRGI
RLQLDSLISGLPGKEMSAMALGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY
VMRCREWYGWHFPEMGKIVTDNLAFAKTVKTMGIRQNAEKIDLSEILPEEVEEEVKAAAE
ISMGTEISEEDITNIIHLCNQVIDITDYRAQLFDYLKNRMTAIAPNLTVLIGELVGARLI
AHAGSLLNLAKHPSSTVQILGAEKALFRALKTKHDTPKYGLIFHATLVGQSAPKNKGKIS
RMLAAKTSLAARVDALGEDGDTSMGIEHRAAVELRLKALEENQLRRISGTGKAQARVDKY
ENKSEVKTYQPATDSTIPSTGKKRKRSETENGEGAEPPASAPVTPSTPATEEDEGEAPAK
KSKKEKKKKKEKEAKMTEEEPEEQAETSSVATPKSEEKKKKKKKKEKKVEDSE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgctagtgctgtttgaaacgccagcaggttatgcagtatttaagcttttagatgagaag
aaattacagcaaatcgataatctttacaaggattttgagaccccagatgctgcaagcaaa
gttgttaaactcaagcactttgaaaagttcaatgacacaactcaggcactggcagctgca
acagcaactgtggaaggaaaaatgagcaaaagtcttaaaaaggtcttaaagaaaattgtt
gccaaggatatccatcaagagttagctgtggctgatgctaagttgggtggggtcattaag
gagaaatttagtttgagctgtgtaacaagttctgctgtgcaggagctcatgcgaggaata
cggttgcagctggatagtttgatatcaggtcttcctggaaaggaaatgagtgcaatggct
ctagggttggctcacagcctgtctcggtacaagctcaagttcagcccagacaaagtggac
actatgattgtccaagcaatttcgctcctggacgatcttgacaaggaactcaacaactat
gtgatgcgctgccgagagtggtatggctggcattttcctgaaatgggcaagattgtgacg
gataacttggcttttgcgaagactgtgaagacgatgggaattcgtcagaatgctgagaaa
atagatttgtctgagattttgcctgaggaagtagaggaggaagtgaaagctgctgcagaa
atatctatgggaactgagatttcggaagaagacatcaccaatataatccatctttgtaat
caggtgattgacataacagactatcgggctcagctttttgactatcttaagaaccgcatg
actgctattgctccgaacttgacggttctaatcggagaactcgtgggggcccgactcatt
gcccatgctggttctcttctcaatttagccaagcatccttcctcgacggtgcagatattg
ggggctgaaaaggctttgttcagggctttgaagactaaacatgacacccccaagtatggt
ttgatttttcatgcgactcttgtcggccagagcgcacccaagaacaaaggaaagatttca
agaatgctcgctgccaagacatcgcttgccgccagggtggacgctctcggtgaagatggt
gatacttctatgggaattgaacacagagcagcggttgaactccggttgaaggcgcttgaa
gaaaatcagctgaggcgaattagtggaactggcaaagctcaagcgagagtggacaagtat
gagaacaaaagcgaagtgaagacctaccagcccgctaccgactcgacaatcccttcaacc
gggaagaaacgaaagagatcagagacagagaacggtgaaggtgctgaaccacctgccagt
gcaccagtaaccccaagcaccccagctaccgaagaagatgaaggcgaagcaccggcaaag
aaatccaagaaagaaaagaagaagaaaaaagagaaggaggcaaaaatgacggaagaagaa
ccagaagaacaggcggaaacgtcttctgtagcgacaccgaaaagtgaagaaaagaagaaa
aagaagaagaaaaaggaaaaaaaggttgaggattccgaatag

DBGET integrated database retrieval system