KEGG   Advenella mimigardefordensis: MIM_c02890Help
Entry
MIM_c02890        CDS       T03016                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
amim  Advenella mimigardefordensis
Pathway
amim00620  Pyruvate metabolism
amim00630  Glyoxylate and dicarboxylate metabolism
amim01100  Metabolic pathways
amim01110  Biosynthesis of secondary metabolites
amim01120  Microbial metabolism in diverse environments
amim01200  Carbon metabolism
Module
amim_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MIM_c02890 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    MIM_c02890 (glcB)
Enzymes [BR:amim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MIM_c02890 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AHG62391
UniProt: W0P6L3
Position
325144..327318
Genome map
AA seq 724 aa AA seqDB search
MTDRTQVHSLQIATVLKNFIDQEALPGTGVDADAFWKGVDALINDLAPENKALLAERDRI
QAKMDEWYRQHPGNIADMQAYKAFLKEIGYLKDAPATVQVNTSNVDYEITNQAGPQLVVP
ITNARYALNAANARWGSLYDALYGTDALSEEDGATRDGGYNPKRGEKVIAFARDFLDQTI
PLQNGSHKDATAYTAENGALSVTLADGSKTTLADADLYLGHRGDAAAPEALVFRQNGLHF
EVQIDKTNPIGKQDKAGVKDVLLEAALSTIMDCEDSIAAVDAEDKVLVYRNWLGLMNGTL
AEEVTKGGKTFTRKLNPDRQYTAKDGKPATLAGRSLMFIRNVGHLMTNPAILDKDGNETP
EGILDAIFTSLVAMHDLKREGGNSRKGSIYIVKPKMHGPDEVAFASKLFGRTEQLLGLAP
NTIKMGVMDEERRTSANLKACIAAAADRVAFINTGFLDRTGDEMHTSMEAGPMIRKGDMK
KSSWIDAYEKRNVLFGLACGLQGKSQIGKGMWAMPDLMADMLAQKGAQLKAGANTAWVPS
PTAATLHALHYHQTDVVQVQNGLKNDTDERLDALLTIPVADNTNWSDAEKQQELDNNAQG
ILGYVVRWVDQGVGCSKVPDIHNVGLMEDRATLRISSQHMANWLRHGIVTEAQVMETMQR
MAGVVDKQNEGDALYRPMVGHFDTSPAFLAACDLVFKGVQQPNGYTEPLLHQWRQKAKQQ
YGIK
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgtacccaggttcacagcctgcaaatcgccaccgtgctgaaaaatttcata
gatcaggaagccctgccgggcactggcgtggacgccgatgcgttctggaagggggtagat
gcgctgatcaatgacctggcgccggaaaacaaggcgctgctggccgaacgtgaccgcatc
caggcaaaaatggatgaatggtaccggcagcaccccggcaatattgccgatatgcaggcc
tataaagccttcctcaaggaaatcggctacctgaaagatgcgccagcgaccgtgcaggtc
aataccagcaatgttgattatgaaattaccaaccaggccggcccgcaactggttgtgccc
attaccaacgcccgttatgccctgaacgcggccaatgcccgttggggtagcctgtatgat
gccctgtacggcaccgacgcgctcagcgaagaagatggtgcaacccgtgatggcggctat
aaccccaaacgcggcgaaaaagttattgcctttgcccgtgattttctggatcagaccatc
ccgctgcaaaacggttcacacaaagatgctaccgcctatacagcagaaaacggtgcgctc
tcagtcaccctggccgacggcagcaaaactacactggccgatgccgacctgtatctgggc
caccgcggtgacgcggccgcgcccgaagcgctggtttttcgtcagaacggcctgcatttt
gaagtgcagatcgacaaaaccaatccgattggcaaacaggacaaggcaggcgtcaaagat
gttctgctcgaagccgccctgtctaccattatggactgcgaagactcgattgcagcagtg
gatgccgaagataaagtgctggtgtatcgcaactggctgggcctgatgaatggcacattg
gccgaagaagtgaccaaaggcggcaaaacctttacccgcaaactgaatcccgatcgccag
tacacagccaaggacggcaaaccagcaacgctggccggccgctcgctcatgttcatccgt
aacgtgggccacctgatgaccaaccctgccattctggacaaggacggcaacgaaacgccc
gaaggtattctggacgcgatcttcaccagcctggtcgccatgcacgatctgaaacgcgaa
ggcggcaactcacgcaagggttccatctatattgtgaaacccaaaatgcacggccccgat
gaagtggcgtttgccagcaaactgtttggtcgcaccgaacagctgctcggcctggcaccc
aacactatcaaaatgggtgtgatggacgaagagcgccgcaccagcgccaatctgaaagcg
tgtatcgcagcagcggccgatcgcgtggccttcatcaacaccgggttcctggatcgtacc
ggtgacgaaatgcacacctccatggaagcgggccccatgattcgcaaaggggacatgaaa
aagtcatcctggatcgacgcttacgaaaaacgtaatgtgctgtttggtctggcttgcggc
ctgcagggcaaatcgcaaatcggtaaaggcatgtgggccatgcccgacctgatggccgat
atgctggcgcaaaaaggcgcgcaactgaaggccggtgccaatacggcatgggtaccttcg
ccaacggcagcaaccctgcatgccctgcactatcaccagactgacgtagtgcaagtacag
aatgggttgaaaaatgacactgacgaacgtctggacgccttgctgaccattccggttgcc
gacaacaccaactggtctgatgccgagaaacagcaggaactggataacaatgcccagggt
attctgggttacgtggtgcgctgggttgaccagggtgttggttgctccaaagtgcccgat
atccataacgttggcctgatggaagaccgtgcgacgttgcgtatttccagccagcatatg
gcgaactggctgcgtcacggtattgtgaccgaagcccaggtgatggaaaccatgcaacgc
atggccggtgtggtggataaacagaacgaaggcgatgcgctgtatcgtccgatggtcggc
cattttgatacctcacctgctttcctggccgcatgcgatctggtcttcaaaggtgtgcag
cagcctaacggctacaccgagccactgctgcatcaatggcgtcagaaagcgaaacagcag
tacggcattaagtaa

DBGET integrated database retrieval system