KEGG   Advenella mimigardefordensis: MIM_c08190Help
Entry
MIM_c08190        CDS       T03016                                 

Definition
(GenBank) ribulose bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
amim  Advenella mimigardefordensis
Pathway
amim00630  Glyoxylate and dicarboxylate metabolism
amim00710  Carbon fixation in photosynthetic organisms
amim01100  Metabolic pathways
amim01110  Biosynthesis of secondary metabolites
amim01120  Microbial metabolism in diverse environments
amim01130  Biosynthesis of antibiotics
amim01200  Carbon metabolism
Module
amim_M00165  Reductive pentose phosphate cycle (Calvin cycle)
amim_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:amim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MIM_c08190
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MIM_c08190
Enzymes [BR:amim01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MIM_c08190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AHG62918
UniProt: W0PD09
Position
926673..927947
Genome map
AA seq 424 aa AA seqDB search
MSDTAVQARYVIETPFDPAKVAEIMAGEQSCGTFTRVAGETDELRDRARATVTAIEALPA
GEVPSLPNAWLERRNVRGPWRRALIDISFPIANIGANLATLAATVSGNLYDLGEVTGLRL
ESLTLPASYRMRFALPRVGISGTRASIGVTAGAMVGTIIKPNVGMSAVQTAALVKTLCEA
GVDFIKDDEVCANPEHAPLAERVPAVMAVIRNHAQRTGKKVMMAFNISDDLDAMRRHAEL
VAQEEGTCVMASLNYCGFSAIESLRKSTPLAIHGHRNGFGAISRHPFLGMAYQPYQTMWR
LAGVDHMHVHGLQGKFSQPDSEVVSAASDSLANMSDTVDDRVLPVFSSGQWAGTVPATWQ
SIQSQDLLFMSGGGILAHPMGPAAGVVSLRQAWAAQRQGVTLDDYARDMPELQSALAFFG
GRQS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacactgcagtacaggcccggtacgtaattgaaacgccgttcgatccggccaaa
gtggccgagatcatggcaggggaacaatcctgcgggacctttacccgggttgcgggtgaa
acagatgaactgcgggatagagcgcgtgccacggtaacggcaattgaagcgttgcccgcg
ggcgaggtgcccagcctgcccaatgcctggctggaacgcagaaatgtgcgcggaccatgg
cgaagggctcttattgatatttcatttccgatagccaatattggtgcaaatctggccacg
ctggccgcgacggtatcaggcaatctttacgatttgggtgaggtgacgggcctgcgtctt
gaatcgcttacgcttcctgcttcctatcgcatgcggtttgctttgccacgcgtgggcatt
tccggtacgcgcgccagtatcggtgtgaccgcgggcgccatggtaggcaccattatcaaa
cccaatgtcgggatgagtgccgtgcagactgccgcgctggtaaaaaccttgtgcgaggcg
ggagtggatttcatcaaggatgatgaagtatgcgccaatccggagcatgcgccactggcc
gagcgcgtacctgcagtgatggctgtgatacggaatcatgcacagcgtaccggcaaaaaa
gtcatgatggcgttcaatatcagcgatgatctggatgcgatgcgccgccatgcagagctg
gtggcccaggaagaaggcacctgtgtgatggccagccttaactattgcggattctctgcc
attgaaagcctgcggaaaagtacgccacttgctatccatggtcatcggaatggctttggt
gccatctcgcgccatccgtttcttggaatggcgtatcagccatatcagaccatgtggcgg
ctggccggggtggatcatatgcatgtacatggtctgcagggaaaattctcccagcccgat
agcgaagtggtgtccgctgcatccgactcgctggctaacatgtccgacacggtcgatgac
cgggtgctgccggtattttcgtcggggcagtgggcggggacggtcccggcgacctggcag
tcgattcaaagccaggatctgctgtttatgtcgggcggcggcatactggctcatcccatg
gggccagcggcaggggtggtcagcctgcgccaggcctgggctgcacagcggcagggcgtc
acgctggacgattacgctcgtgatatgcccgaactgcagtctgcactggcattttttggt
ggccggcaatcatga

DBGET integrated database retrieval system