KEGG   Advenella mimigardefordensis: MIM_c08840Help
Entry
MIM_c08840        CDS       T03016                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
amim  Advenella mimigardefordensis
Pathway
amim00270  Cysteine and methionine metabolism
amim00920  Sulfur metabolism
amim01100  Metabolic pathways
amim01110  Biosynthesis of secondary metabolites
amim01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amim00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MIM_c08840 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MIM_c08840 (metX)
Enzymes [BR:amim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     MIM_c08840 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     MIM_c08840 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Esterase Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AHG62983
UniProt: W0PD64
Position
993490..994686
Genome map
AA seq 398 aa AA seqDB search
MVSQHTTSQQSVGVVTPQFLQFDQPLTLSSGQVLPSYTLAVETYGTLNAQRSNAVLVCHA
LNASHHVAGVSATDAKDVGWWDNMVGPGKPVDTNIYFVIGVNNLGSCFGSTGPASIDPAT
GKPWGSTFPVVTVEDWVRAQARVADHFGIDRFAAVMGGSLGGMQALSWAIELPERIAHCV
VVASTTNLSAQNIAFNEVARRAIISDPDFHGGNYYEYNTVPARGLSVARMVGHITYLSDD
DMAEKFGRAQRNPTEDGRYRFGYDVEFEVESYLRYQGEKFSRYFDANTYLLITRALDYFD
PASKHGGDLTEALRPATAEFLTVSFSTDWRFPPERSRELVKALLKNGQPVTYAEIDAPHG
HDAFLLDDPRYHAVVRAYYQRIAASLNLTATPLEQETA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggtctcacaacatactacttcacagcagtctgtgggcgtggttacgccccagtttctc
cagttcgatcaaccgctcacgctcagcagtggccaggtgctgccgtcgtacacgcttgcc
gtggaaacctacggtacgcttaacgcccagcgcagtaatgccgtgctggtttgccatgcg
ctcaacgcatcgcaccacgttgcaggggtctcggccaccgacgccaaagatgtcggctgg
tgggacaatatggtcggaccgggaaagccggtagatacgaatatttattttgtcattggc
gtaaacaatctgggttcctgcttcggttcaacgggtccggcatcgattgaccctgccacg
ggcaagccctggggatcaacctttccggtggtcacggtggaagactgggtcagggcacag
gccagggtggcagatcattttggcattgatcgctttgctgccgttatgggtgggtcgctt
ggcgggatgcaggcgctgagctgggccattgaattgcccgagcgcatcgcgcactgcgtg
gtggtggccagtaccaccaatctgtcggcacagaatattgcctttaatgaagtggcgcgg
cgcgcgattatcagcgaccccgatttccatggtggcaattattatgaatacaataccgtg
ccggcgcgcggcctgtcggtcgcacgcatggtggggcatatcacgtatctgtcagatgat
gacatggccgaaaaattcggacgtgcgcaacgcaatccaaccgaagatgggcgctaccgg
ttcggctacgatgttgaattcgaggtcgagtcttatttgcgttatcagggggagaaattt
tccagatatttcgatgccaatacttatttgctcattacacgggcgctggattacttcgat
ccggccagcaagcatggtggtgatctgaccgaagcattgcgtccggcaacggcggaattt
ttgacggtgtcgttttccaccgactggcgctttccgccggaacgctcgcgcgaactggtc
aaggcgctgctcaaaaacggccagccggtgacgtatgcggaaatcgatgccccgcatggg
catgacgctttcctgctggatgacccgcgctatcatgcggtggtcagggcttactaccag
cgcattgccgccagtctgaatctgacagcgacgccattggagcaggaaacagcatga

DBGET integrated database retrieval system