KEGG   Advenella mimigardefordensis: MIM_c22400Help
Entry
MIM_c22400        CDS       T03016                                 

Definition
(GenBank) putative acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amim  Advenella mimigardefordensis
Pathway
amim00071  Fatty acid degradation
amim00072  Synthesis and degradation of ketone bodies
amim00280  Valine, leucine and isoleucine degradation
amim00310  Lysine degradation
amim00362  Benzoate degradation
amim00380  Tryptophan metabolism
amim00620  Pyruvate metabolism
amim00630  Glyoxylate and dicarboxylate metabolism
amim00640  Propanoate metabolism
amim00650  Butanoate metabolism
amim00900  Terpenoid backbone biosynthesis
amim01100  Metabolic pathways
amim01110  Biosynthesis of secondary metabolites
amim01120  Microbial metabolism in diverse environments
amim01130  Biosynthesis of antibiotics
amim01200  Carbon metabolism
amim01212  Fatty acid metabolism
amim02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MIM_c22400
   00630 Glyoxylate and dicarboxylate metabolism
    MIM_c22400
   00640 Propanoate metabolism
    MIM_c22400
   00650 Butanoate metabolism
    MIM_c22400
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MIM_c22400
   00072 Synthesis and degradation of ketone bodies
    MIM_c22400
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MIM_c22400
   00310 Lysine degradation
    MIM_c22400
   00380 Tryptophan metabolism
    MIM_c22400
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MIM_c22400
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MIM_c22400
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MIM_c22400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amim04147]
    MIM_c22400
Enzymes [BR:amim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MIM_c22400
Exosome [BR:amim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MIM_c22400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHG64318
UniProt: W0PH99
Position
complement(2552380..2553546)
Genome map
AA seq 388 aa AA seqDB search
MRVSMTGWAHSRFGKMDGIDPEQMIGDVALQAIEHAGLEQSDIDSLHVGHYNGGFLYQDF
PSSLLFNTMPALRFIPSVRLENACATGSAALHSALNAVSSGRSRYALVLGFEKMSELSTP
EIGEVLLKCSYAREEAAVAGGFAGLFGNVIAKTYFDRYGDQSDALAMIAAKNHHNGLSNP
YAHMRKDFGFDFCRTESEKNPFVAGPLKRTDCSLVSDGAAAVIICRDDDVRNSDNRVRFL
ATSQVNDYLPMSRRDPIAFEGATRAWQQALADSSLSLNELSFVETHDCFTIAELIEYEAM
GLARPGEGARVILDGISARDGRLPVNPSGGLKSKGHPIGATGVSMHVMAAMQLSGQAGDM
QLPVADRAGVFNMGGSAVANYVSILERA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgtcaatgacgggctgggcccattccaggttcggaaaaatggatggcatcgac
cccgagcagatgatcggggacgtagcgctgcaagctattgagcatgccggtctggagcag
agtgatatcgattcgctgcacgtcggtcattacaacggtggatttctatatcaggatttc
ccttcatcgttactgtttaacacgatgccggcattgcgatttattccgtctgtgcgactg
gaaaacgcctgcgccacaggctcggcggcgctgcactctgcgcttaacgcggtcagcagc
ggacgcagtcgttacgcgctggtactgggttttgaaaaaatgtcggaactgtcaacaccg
gagatcggcgaagttctgctcaaatgttcctatgccagggaagaggcggcagttgcaggt
ggttttgccggccttttcggcaatgtgattgccaaaacctattttgatcgctacggcgac
cagtctgacgctttggcaatgattgctgccaagaaccaccacaatggcctgtccaatccg
tacgcccatatgcgaaaggatttcggtttcgatttctgtcgtacagagtctgaaaaaaat
cccttcgtcgccggcccgcttaaacgtaccgactgttccctggtctctgacggcgcggcc
gccgtgattatctgcagggacgatgatgttcgcaatagcgacaatcgtgtacgttttctg
gcaacgtctcaggtaaatgattatttgccgatgagccgtcgggaccccattgcatttgaa
ggtgcgacgcgggcctggcaacaggcgctggccgatagcagtctgagcctgaacgagctg
tcgtttgttgaaacccatgactgctttaccattgccgagctgattgaatatgaggccatg
gggctggcccgcccgggcgaaggggcgcgtgtgatcctggatggcatcagcgctcgtgac
ggacgcctgcccgtgaatccctcgggtggcctgaagtccaaagggcaccccatcggtgcg
acaggcgtttccatgcatgtgatggctgcgatgcaattgagcggacaggctggcgatatg
caattgccggtggcggatcgggcgggtgtcttcaatatgggtggctcggcagttgccaat
tatgtgagtattcttgaacgcgcgtga

DBGET integrated database retrieval system