KEGG   Aurantimicrobium minutum: AUMI_115550Help
Entry
AUMI_115550       CDS       T05175                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
amin  Aurantimicrobium minutum
Pathway
amin00020  Citrate cycle (TCA cycle)
amin00640  Propanoate metabolism
amin00660  C5-Branched dibasic acid metabolism
amin01100  Metabolic pathways
amin01110  Biosynthesis of secondary metabolites
amin01120  Microbial metabolism in diverse environments
amin01130  Biosynthesis of antibiotics
amin01200  Carbon metabolism
Module
amin_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amin_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AUMI_115550
   00640 Propanoate metabolism
    AUMI_115550
   00660 C5-Branched dibasic acid metabolism
    AUMI_115550
Enzymes [BR:amin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AUMI_115550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAV00098
UniProt: A0A173LZ07
Position
sequence1:1597987..1599150
Genome map
AA seq 387 aa AA seqDB search
MDLYEYQARDLFESYDVPVLAGIIADTPAEARAAAEKLGGVVVVKAQVKVGGRGKAGGVK
VAKTPEEAEEAAKAILGLDIKGHVVKRVMVAAGARIAQEFYFSVLLDRANRSYLSLTSYE
GGMEIEQLAVERPEALARIEVNPIKGIDLEEAKKIAVAAKFPSELVDKVAPVFVKLYEVY
TGEDATLVEVNPLVLTEEGDIIALDGKVSLDENAEFRHENHAALEDKAAADPLEAKAKAA
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGENHGGVKPANFLDIGGGASAEVMAAGLD
VILGDAQVKSVFVNVFGGITACDAVANGIVQALATLGSAANKPLVVRLDGNNVDEGRRIL
AEANHPLVTLADSMDDGADKAAELAAR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtggatttatacgaataccaagccagggacctgttcgagagttatgacgttcccgtactg
gcgggcatcatcgcagacacccctgctgaagcacgtgctgcagctgaaaagctcggtggc
gtagttgtcgtcaaagctcaggttaaggtcggtggccgcggtaaggccggtggcgtcaag
gttgccaagacccctgaggaagctgaagaagccgccaaggccattcttggactcgacatc
aagggacacgtcgtcaagcgcgtcatggttgcagctggtgctcgcatcgctcaggagttc
tacttctcggtgctgcttgaccgtgcaaaccgctcctacctttccctcacctcctacgaa
ggtggcatggagattgagcagctcgctgtggaacgccccgaagctctcgctcgcatcgaa
gtaaaccccatcaagggcatcgacctcgaggaagctaagaagattgctgtggcagcaaag
tttccatctgagctcgtggataaggttgctcctgttttcgtcaagctctatgaggtctac
accggtgaagacgcaaccctggttgaagtgaacccactggttctcaccgaagaaggcgac
attattgccctcgacggtaaggtctcgctcgatgagaacgctgagttccgtcacgagaac
cacgcagcactcgaagacaaggcagctgcagatccactcgaggctaaggctaaggctgca
gacctcaactacgtcaagcttgacggagaagtcggcatcatcggtaacggtgctggtctc
gtgatgagtaccctcgacgttgttgcttacgctggtgaaaaccacggtggtgtcaagccc
gcgaacttcctcgacatcggtggtggagcttctgctgaagtgatggcggctggtctcgac
gtcatcctcggtgacgcccaggtcaagagcgtattcgtcaacgtcttcggtggcatcacc
gcatgtgacgctgtggcgaacggtatcgtccaggcactggcaacccttggttccgctgct
aacaagcctctggttgttcgccttgacggcaacaacgtcgacgagggtcgtcgtatcctc
gccgaggcaaaccacccacttgtaaccctcgcagacagcatggatgacggcgccgacaag
gccgctgaactcgctgcccgctaa

DBGET integrated database retrieval system