KEGG   Alligator mississippiensis (American alligator): 102557879Help
Entry
102557879         CDS       T03087                                 

Gene name
PIGT
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    102557879 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 102557879
NCBI-ProteinID: XP_014465089
UniProt: A0A151NZ59
Position
Un
AA seq 579 aa AA seqDB search
MERAAVLGLLLLLGARGGSGQAALEPPQDSLREELLLSPLPSGDLAATFQFQTRWDSELQ
REGVSHYRLFPKALGQLISKYSVRELHLSLTQGFWRTRTWGQPHLQAPAGAELWVWFQDS
VTDVDKSWKELSNMLSGIFCASLNFIDSTNTVTPTASFKPLGLANVTDHHLLRYAVLPRE
VVCTENLTPWKKLLPCSSKAGLAVLLKAERLFHSSYHSQAVHIRPICRDVSCLSISWELR
QTLTVVFDTFSSGQGKKDWSLFKMFSRTVTEACPLASESKIYVDISSKDQGNELLEVTPA
PLSMHEAVVLGDRRTYAVYDLLSPALFNTSRSLNVQLKWKRPQDSADLSTPVLHAQRYVS
GYGLQTGEISTLIYNTHPYRAFPVILLETVPWYLRLYIHTLTIITKGKENKPSYIHYQPA
QDRRRPHLLEMLIQLPANSATKITIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSIV
AAKAVDVEESPLFTSLFPSSDGSSYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVC
YGSFYNLLTRTFHVEEPSRGGLAKRLANIIRKMRGVPPL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggccgcggtgctggggctcttgctcctgctgggggcccgcggcggctccggg
caggcggcgttggagccgccccaggacagcctgcgggaggagctgctgctcagcccgctg
ccgtccggagacctcgccgctaccttccagttccagacccgctgggactcggagctgcag
cgggagggagtctctcactacaggctcttccccaaggccctggggcagctcatctccaag
tactctgtgcgcgagctgcacctgtccctcacccaaggcttctggcgcacgcggacctgg
ggacagcctcacctgcaggccccggctggagctgagctatgggtctggttccaggactcg
gtcaccgatgttgacaagtcctggaaagagctcagcaacatgctctcggggatattctgt
gcctccctgaacttcattgactccaccaacacagtcactccaacagcatcattcaaacct
ctgggcctagccaatgtcacagatcaccacctcctgagatatgctgtcctgccccgtgag
gtcgtctgcaccgagaacctcactccttggaagaagctgctgccatgcagctcaaaggct
ggtcttgctgtgttgctgaaggctgaacgcttgttccatagcagctaccactcacaggca
gtgcatatccgccccatctgcagggatgtttcatgcctcagcatttcctgggagctccga
caaactctcactgtggtcttcgacaccttctccagtggccaaggaaagaaagactggtcc
ctttttaagatgttttcacgtactgtcactgaagcttgtcctctggcctctgagagcaaa
atctatgtggacatctccagcaaggatcaggggaacgagctgctggaggtgaccccagct
ccactgtctatgcatgaagcagttgtcctaggagacaggagaacctatgcagtctatgac
ttactgagcccagcactcttcaacacatctcgcagcctcaatgtgcagctgaaatggaaa
cggccccaagacagtgctgatctctcaacaccggtgctccatgctcaacgctatgtgagt
ggatatggcctgcagactggagaaatcagcaccctgatctataacactcatccctaccgt
gccttccctgtgatactactggagacagtgccctggtacctgagactgtacattcacact
ctgaccatcatcaccaaggggaaggagaacaagccaagttacatccactaccagccagct
caggaccgaaggcggccccatcttctggagatgctgatccagctcccagcaaactctgcc
accaagatcaccatccaattcgagagagccttactgaaatggacagagtacacacctgac
cctaaccacgggttttacgtgagtccatctgtcctgagtgccctggtgccaagtatcgtt
gcagcaaaagctgtagatgttgaggagagtcctctcttcacctcactatttccttcttct
gatggctcaagctactttgtgcgtctctacacagagccgcttcttgtgaacttgccaaca
cctgacttcagcatgccatataatgtcatctgcctcacctgcaccgtggtggccgtgtgc
tatggctccttctacaacctgctgaccagaacctttcacgtggaagagcctagcaggggg
ggcctggccaagagactggctaacatcatccgcaaaatgaggggggttcctcccctctga

DBGET integrated database retrieval system