KEGG   Alligator mississippiensis (American alligator): 102558254
Entry
102558254         CDS       T03087                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amj03000]
    102558254 (AHRR)
Transcription factors [BR:amj03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102558254 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_11 PAS_4
Other DBs
NCBI-GeneID: 102558254
NCBI-ProteinID: XP_019346683
Position
Un
AA seq 754 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQENHFKKHCDQISKDNISSKPSIQEGRLLLESLNGFA
LVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQVESG
QHLPTETGEDHMLRKLFKAQESDGVTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGKL
KFLFGQKKKSPSGAILPPKLSLFCIVVPLLLPSVMEMKMKSLLMKTKQKAEEASPIDTKS
KTSSGLCETESNGRISYHEGPAFTNVLQSGENQTKAKNNGESGIALVKVQTNEDQWVWVQ
ASTQVLYRSGCSEYVIGSQQTLKEEDEHLKIPSNVTCLKGNREALTYNCAIEAVGQMKHI
NWTTLKNEQDNIKVKFEPSTNDKGFLQEDPLNADMLLSGVQNNYNTNSVWTLRNSSSSCS
INQCNSCPNRIVRPFYSRDQSFLNLATTCPSHWGSTENCQSYSGLQQLKTENYNTERMKL
QHSLISPETLFDTTFSPEIPIKTEYDSDSESVADNHTASQNQVWMDDKGTVRKQLISYPN
KVHLKTELDLSEQLSLCQKPKHYVGTSHSWQCIVTNHTNNLNINRPCKGFCNKEVMSFCL
PNSACLESMHDMPYTGCYTQFYSPSTREEEGQNNQIFKMQCHLKNPCLVQSIKREPLDSP
SLSDNGQNGVQVILPENTLLDPVSHKPTECTFLQ
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgatacctcctggggaatgcctatatgctgggagaaaaaggaggaaacccattcagaaa
caaaggcctgcagttgggaatgaaaaatctaatccttcaaagagacatagggaccgtctg
aatgctgaattagatcatctagccagcctcctgcctttcccacctgacatagtatctaaa
ttggacaaactttctgtcttgcgcctcagcgtcagctatctccgagtcaaaagtttcttt
caagctattcaagaaaaccacttcaagaagcattgtgatcaaataagcaaagacaacata
tccagcaaacctagtatacaagaaggtagacttctgctagaatcactgaatggttttgca
ctggtggtgagtgcagatggaatgatattttatgcatcatcaactattgtggattatcta
ggctttcatcagacagatgtaatgcaccaaaacatatatgattacatccacgtagatgat
cgccaagatttctgtagacaactgcattgggccatgaatcctccacaggtggagtctggg
caacatttaccaactgaaacaggagaagatcatatgctcaggaaattgtttaaagcacaa
gaatctgatggtgtgacaacagactattcttcttttttaactcgctgtttcatctgtcga
gttcgctgcctgttggacagtacttctggctttcttacaatgcagtttcaaggcaaactt
aagtttctttttggacaaaaaaagaagtccccttcaggagcaatattaccacctaagctg
tccttattctgcatagtggtgccacttctgcttccttctgtcatggagatgaagatgaaa
agtctgctcatgaaaacaaaacagaaagctgaagaggcatccccaatagacacaaagtca
aaaactagttcaggtctgtgtgaaacagagtcaaatggaagaatcagttaccatgaaggt
ccagctttcactaatgtgttacaaagtggtgaaaaccagaccaaagcaaagaataatgga
gaaagtggtattgcccttgtcaaagtacaaacaaatgaagatcagtgggtctgggtacaa
gccagtactcaagttctctatagaagtggctgttcagaatatgtcattggttcacagcaa
acactaaaagaagaagatgagcacctgaagataccaagcaacgtcacctgtttgaaagga
aaccgggaagctcttacctataattgtgccattgaagctgtgggacagatgaagcatatc
aattggacaacactaaaaaatgaacaggataacataaaagtgaagtttgagcctagtaca
aatgacaagggttttctgcaagaggaccctctgaatgctgatatgttactttcaggtgtc
caaaacaactataacacaaacagcgtttggactttaaggaactcatcaagttcttgttcc
ataaatcagtgcaattcatgtccaaacagaatagtcagaccgttctatagcagagaccaa
agctttttaaatttagcaacaacctgtccttcccactggggtagcacagaaaattgccag
tcttattcaggcttacagcagctaaaaacggagaactacaatacagagcgtatgaaattg
cagcattcattaatatccccagaaactctgtttgatacaacattttctccagagatacct
attaagactgaatatgattctgattctgaaagtgtagctgacaaccacacggcatcacaa
aatcaagtctggatggatgataaaggcacagtgagaaaacagctgattagttaccctaac
aaggtgcaccttaaaacagaactagatctcagtgagcagctttctctttgtcaaaagcca
aagcactatgttggcacatcacatagttggcaatgcattgtaacaaatcatactaacaat
ctcaacataaacaggccttgtaaagggttttgtaacaaagaggtgatgtcattttgcctc
ccgaactctgcatgtttggaaagcatgcacgacatgccatatacaggatgctacacacag
ttctatagccctagtacaagagaagaagaaggacagaacaaccagatttttaaaatgcag
tgtcatcttaaaaatccctgcttggttcaaagtatcaagcgtgagcccttggattctcca
tccttgtctgataatggccagaatggagtacaggtgatcctccctgaaaacactttacta
gatcctgtgtctcataaaccaacagaatgtacattcttacagtag

DBGET integrated database retrieval system