KEGG   Alligator mississippiensis (American alligator): 102558360Help
Entry
102558360         CDS       T03087                                 

Gene name
ERLIN1
Definition
(RefSeq) ER lipid raft associated 1
  KO
K23341  erlin
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:amj04121]
    102558360 (ERLIN1)
Ubiquitin system [BR:amj04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    102558360 (ERLIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346
Motif
Other DBs
NCBI-GeneID: 102558360
NCBI-ProteinID: XP_019343961
Position
Un
AA seq 373 aa AA seqDB search
MGRKSPSQFVTAACQLLLSCRCDDVKMTMAQAGAVVATATGVLLFLLCASIHKVEEGHLA
VYYRGGALLTNPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVV
NMLAPYAVYDIVKNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIELFDQIDENLKLAL
QKDLNVMAPGLTIQAVRVTKPKIPEAIRRNFELMEAEKTKLLIAVQKQKVVEKEAETERK
KALIEAEKAAQVSKIHYQQKIMEKETEKRISEIEDAAFLAREKAKADADYYTAQKVADSN
KLKLTPAYLELVKYQAIAANSKLYFGDSIPSMFLDSCTFKHVWQRTAQDPSLPLKEAAEP
CGESCLENEENAG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggaagtctcccagtcagtttgtgacggcagcatgccagctgctcctgagttgt
agatgtgatgatgtgaaaatgaccatggcccaggctggagcagtagttgcaactgcaaca
ggagttctgctttttctcctctgcgcctccattcacaaagtcgaggagggtcacctggct
gtgtattacaggggtggtgcgttattaaccaacccaagtggaccaggctaccacatcatg
ctcccattcattaccacgttcaaatcagtacagactacattgcaaactgatgaagtgaaa
aatgtgccttgtgggacgagtggtggggttatgatctacattgatcgaatagaagttgtg
aatatgttagctccgtatgcagtgtatgacattgtgaagaactacactgcagactatgat
aagaccctcatcttcaataaaattcaccatgagctgaatcagttctgcagtgcccacaca
ctccaggaagtgtacattgagctgtttgatcagatagatgagaatttgaagttggcctta
cagaaagatctcaatgtcatggcaccaggtctcaccatccaggctgtgcgtgttacaaag
cccaaaatccctgaggccatccgaagaaattttgagctaatggaagctgagaagaccaaa
ctgctcatagcagtccagaagcaaaaagttgtggagaaggaggcagagacggagaggaaa
aaggctctcatagaggcagagaaggctgctcaggtgtccaagattcattatcagcagaaa
atcatggaaaaagagacggagaagcgtatttctgagattgaagatgctgctttcctagca
agagagaaggcgaaggctgatgcagattattacactgctcagaaagtggcagactccaac
aagctgaaactcacgccggcatatctggagctagtgaaatatcaagccattgctgcaaac
agtaagctgtattttggtgacagcatccccagcatgtttctggattcctgtactttcaaa
catgtgtggcagaggactgcacaagaccccagcctgcccttgaaagaggccgcagaaccc
tgtggggaaagctgcctcgaaaatgaagagaatgcaggctga

DBGET integrated database retrieval system