KEGG   Alligator mississippiensis (American alligator): 102559269Help
Entry
102559269         CDS       T03087                                 

Definition
(RefSeq) selenide, water dikinase 2
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00450  Selenocompound metabolism
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102559269
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amj03016]
    102559269
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     102559269
Transfer RNA biogenesis [BR:amj03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    102559269
 Prokaryotic Type
    102559269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 102559269
NCBI-ProteinID: XP_019353685
Position
Un
AA seq 333 aa AA seqDB search
MDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLS
VSQKMTDEEREKIMPLIIKGFRDAAEDGGTSVTGGQTVMNPWIIVGGVATVVCQPNEFIM
PDNAVPGDVLVLTKPLGTQVAVTAHQWLDNPERWNKIKLVVSKEDVELAYQEAMFSMAML
NRTAASLMHTFNAHAATDITGFGILGHAQNLARQQRHEVSFVIHNLPIIAKMAAVSKACG
NRSGLLQGTSPETSGGLLICLPREQAARFCAEIKSPKHGEGHQAWIIGIVEKGNQTARII
DKPRIIEVMPRGAAATASPTDNTAGASPEGAAS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggactcgtgcgtcattcccctgcggcacgggggcctctctctggtgcagaccacggat
ttcttctaccctctcgtggaggatccttacatgatgggtcgcatcgcttgtgccaacgtg
ttgagcgatctctacgccatgggcatcacagagtgcgacaacatgctgatgctgctcagt
gtcagccagaagatgactgatgaggaacgtgagaagatcatgccactgatcatcaaaggt
ttccgggatgctgctgaggatggcggcacatcggtgacaggtggtcagactgtgatgaac
ccctggatcattgttgggggtgttgccactgtggtctgccagcccaatgagttcatcatg
ccagacaatgcagttcctggcgatgtgctggttctcacgaagcccctgggcacacaggtg
gctgtcaccgctcaccagtggctggataatcctgagcggtggaacaagatcaagctggtg
gtctccaaggaggatgtggagctagcctaccaggaagccatgttcagcatggccatgctg
aaccgaacagcggccagcctgatgcacactttcaacgctcacgcagccacggacatcacg
ggcttcgggatcctgggccatgcgcagaacctagccaggcagcagcgccatgaagtttct
tttgtcatccacaatctgcccatcattgccaagatggctgcagtcagcaaggcctgcggg
aaccgctccgggctgcttcagggcacgtctccggagacctcaggggggcttctgatctgc
ctaccccgggagcaggccgcacgcttctgtgctgagatcaagtcccccaagcatggtgag
ggccaccaggcctggatcatcggcatcgtggaaaagggcaaccagactgcacgcatcatt
gacaagccccgcatcatcgaggtgatgcctcggggggctgcagccactgcctcacccacc
gacaacacagctggggccagccctgagggtgctgcctcctga

DBGET integrated database retrieval system