KEGG   Alligator mississippiensis (American alligator): 102559536
Entry
102559536         CDS       T03087                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amj01002]
    102559536 (ERAP1)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102559536 (ERAP1)
Peptidases and inhibitors [BR:amj01002]
 Metallo peptidases
  Family M1
   102559536 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102559536
NCBI-ProteinID: XP_006261663
Position
Un
AA seq 935 aa
MKTLLLLSVLSIAGSVSSNHHSGTSETDHAASGNGSKLFPWDKMRLPKHVTPVHYDLLIH
PNLTTLTFTGFAKIEVTVNQQTTSIILHSKHLQITKATIQGGKGNSHAETEVMVWEHPPF
EQIALLASEPLQVGQNYTVHIEYSANLSESFHGFYKSSYRTQEGEVRVLAITQFEPTAAR
MAFPCFDEPSFKAQFSVKIRREPKHLALSNMPIVRSVNISKWLVEDHFDVSVKMSTYLVA
FIVSDFKSVSKMTRHGIKISIYAVPDKINQADYALDAAVKLLDFYEDYFSIPYPLPKQDL
AAIPDFQSGAMENWGLTTYRESALLYDSEKSSASSKLWITMIIAHELAHQWFGNLVTMEW
WDDLWLNEGFAKFMEYVSVSVTHPELKVEDYFLGKCFDAMEVDALNSSHPISTPVEDPAQ
ILEMFDDVSYEKGACILNMLWNYLTADVFKAGIVQYLRNYSYRNTKNEDLWNSLTNICPV
DGTHESQLQSDGFCTRNQQTSSSSHWTRRETLEVGTMMNTWTLQKGFPLITVMAKGKNVY
LRQEHYMKGSHSSPPTGYLWHVPLTYITSKSDTVQRFLLTTKTDVLILPEEVEWIKFNVG
MNGYYIMHYEDDGWDNLISILKENHTAISSNDRASLINNVFQLVSIGKLSISKALDLTLY
LNHESQIMPVFQGMNELIPIYKLMEKRDMDDVENQLKEYIVNIFKNLIDKQSWNDEGSVS
ERLLRNSLLLFACARKYQPCVDKAEEYFMKWKESDGTLRLPNDVKAAVYTVGAQTVEGWD
FLFSKYRLPSFNTEKNEIEVALSISRNKEKLQWLMDQGLLGDIVKTQDLPHIVVFVAKNP
SGYHLAWKFLKENWNKLAQKFELGSHSIAGMVIGVTNQYSTREQLAQVKEFFSSLDEKSS
HLRCIQQAIEIIEENIRWMDINFEQIKLWLQNNKI
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgaagacactactgttgttaagtgttttgagtattgcagggtctgtgagcagcaaccac
cacagtggaactagtgagacagaccatgcggcctctggtaatggaagcaaactgtttcct
tgggataaaatgaggcttcccaagcatgtcaccccagtgcattatgatctactcatccac
cctaatctcaccactctgacgtttactggctttgccaagatagaagttacagtaaaccaa
caaaccacttcaatcatcctgcacagcaagcacctgcagattaccaaagccaccatccaa
ggaggaaaaggaaatagtcatgcagaaacagaagtgatggtttgggaacaccccccattt
gaacagattgcactccttgcttctgaaccactgcaagttggacaaaactatacagtccac
atcgagtattcagccaatctatcagagagtttccatggcttttataaaagtagttacaga
actcaggaaggagaagtgagagtacttgccataacacagtttgaaccaacagctgcacgc
atggccttcccatgttttgatgaaccatccttcaaagcccaattttcagttaagattagg
agagaaccaaagcaccttgcactatctaatatgccaatagtgagatctgtgaatatttcg
aaatggcttgttgaggaccattttgatgttagtgtaaagatgagtacttatcttgtggcc
tttatagtttctgattttaaatcagtcagtaagatgacccgtcacggaattaagatttcc
atctacgctgtgcctgacaaaatcaaccaagctgattatgccttggatgcagcagtgaaa
cttttagacttctatgaagattactttagcattccataccccttacccaaacaagaccta
gctgctattcctgattttcagtctggtgctatggaaaattggggattgactacatacagg
gaatctgctttgttatatgactctgaaaaatcttcagcatcaagtaaactctggattaca
atgatcatagcccatgagctagctcaccagtggtttggaaacctagttactatggaatgg
tgggatgatctttggctaaatgaagggtttgcaaagtttatggaatatgtgtcagtcagt
gttacccatccagaactgaaagttgaagattattttttaggcaagtgttttgatgccatg
gaggtggatgcattgaattcttcacatcctatatctactcctgtggaagatccagctcaa
attctagaaatgtttgatgatgtttcctatgagaagggagcttgtattctgaacatgctg
tggaattacctgactgcagatgtgtttaaagctggtattgtacaatatctccggaattac
agctatcggaatacaaaaaatgaagatttgtggaatagtctgacaaatatttgtcctgta
gatggcacccatgaaagccaacttcaaagtgacggtttttgcaccagaaaccagcagaca
tcttcaagttcgcactggacaagaagagagacccttgaggttgggacaatgatgaacact
tggacattacaaaagggttttccattaataactgtcatggcaaaaggaaagaatgtctat
ctgcggcaagaacattatatgaagggatctcattcttctccaccaacagggtatttgtgg
catgttccattaacatatattaccagtaaatctgacaccgttcaaagatttttgctgaca
actaaaacagatgtcctcatcctccctgaagaagtggaatggataaaattcaatgtgggg
atgaatggatattacattatgcactatgaagatgatggatgggataatctgattagcatt
ttaaaagaaaaccacacagcaattagcagcaatgatagagcaagtctcattaacaatgta
ttccagcttgtgagcattggaaaactgtcgatttccaaagctcttgatttaactttgtac
ttaaaccacgaatcccaaattatgcctgtattccaaggtatgaatgagctgattcctata
tataagctcatggagaagagggacatggatgatgtagaaaaccagttaaaggagtacata
gtcaacatatttaaaaatctaattgataaacagtcctggaatgatgaaggctcagtctct
gaacgattgcttcgtaattccctcctcctgtttgcttgtgcacgcaaataccaaccatgt
gtggacaaagcagaagaatattttatgaagtggaaggaatctgatggaactttacgttta
cccaatgatgttaaggcagcagtgtatactgttggagcacagacagttgaaggttgggac
ttcctctttagtaaatacaggctgccttcattcaacactgagaaaaacgagattgaagtt
gctctcagtattagcagaaataaagaaaaacttcagtggttaatggatcaaggtttgttg
ggtgatatagtaaaaacccaggatcttccacatatcgtggtgtttgttgccaagaaccca
tctggttatcacctagcttggaagtttctgaaggaaaattggaataagcttgcacaaaag
tttgaacttggctcgcactccatagcagggatggtaattggagtgacaaaccaatactct
acaagagaacagcttgcacaggtgaaagaattcttcagttctctggatgaaaaaagttca
catctccgttgtatccaacaagcaatagaaataattgaagaaaatatacgatggatggat
ataaactttgagcaaatcaaactatggctacaaaacaacaaaatataa

DBGET integrated database retrieval system