KEGG   Alligator mississippiensis (American alligator): 102561217Help
Entry
102561217         CDS       T03087                                 

Gene name
METTL14
Definition
(RefSeq) methyltransferase like 14
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amj03019]
    102561217 (METTL14)
Enzymes [BR:amj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     102561217 (METTL14)
Messenger RNA biogenesis [BR:amj03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     102561217 (METTL14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 102561217
NCBI-ProteinID: XP_006259721
Position
Un
AA seq 461 aa AA seqDB search
MAMNIRLQEIRERQKLRRQLLAQQLGAENADSIGAVLNSKDDQREIAETRETCRASYDTS
APGLKRKYPDEGEADEEEIEDYKDEVELQQDEENLPYEEEIYKDSSTFLKGTQSLNPHND
YCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADLEAFD
IRELKSKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIEEIAAPRSFVFLWCGSG
EGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVRR
STDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWL
TVGPTLTNSNFNAETYASYFTAPNSHLTGCTEEIERLRPKSPPPKTKSDRGGGAPRGGGR
GGTSAGRGERGRERNRTNFRGERGGFRGGRGGTHRGGFPAR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaatatccgcttgcaggagatccgggagcggcagaagttgcggcggcagctc
ctggcccagcagttaggagctgaaaatgctgacagcatcggcgcagtattgaacagtaaa
gatgaccagagggaaattgcagaaacaagggaaacctgcagggcttcttatgatacctca
gcaccaggtttaaaacgcaaatatccagatgagggggaggctgacgaagaagaaattgaa
gattataaggatgaagtagagctgcagcaagatgaagagaacctgccctatgaagaagag
atttacaaagattccagtaccttccttaagggaacccagagcttaaatcctcacaatgat
tattgccagcacttcgtggataccgggcacaggcctcagaactttatcagagatgtgggc
ttagcagacaggtttgaagaatatccaaaacttcgagaactcattagactgaaggatgag
ctaattgctaaatctaacactccccccatgtatttacaagcagacttggaggcttttgac
attagggaactaaaatccaagtttgatgtgattctgttggaacctccattggaagaatat
tacagagagactggcatcacagccaatgaaaaatgctggacttgggatgatattatgaaa
ctggaaattgaagagattgcagccccaagatcatttgtctttctatggtgtggctcagga
gagggcctggatcttggcagagtgtgtctacgcaagtggggttacagacgatgtgaagat
atctgctggataaaaactaataaaaacaaccctgggaagactaaaacgctggaccctaaa
gctgtgttccaaagaacaaaggagcactgccttatgggaattaaaggaacagttcgccgc
agtaccgatggtgacttcattcatgctaatgttgatattgacttaattatcacagaagaa
cctgaaattggcaacatagaaaaacctgtagagatctttcacatcatcgaacacttctgc
ctcggaagacgacggcttcaccttttcggaagggatagtactatccgcccaggctggctg
actgtgggacctaccctcacaaacagtaactttaatgcggagacatatgcatcctacttt
actgctccaaattctcatctgactggctgtacagaagagatcgagagacttcgaccaaaa
tcgccacctcccaaaacgaagtcagaccggggaggtggagctccccggggcggaggcaga
ggtggaacttcagctggccggggagaaaggggcagagagaggaacagaactaacttccgg
ggtgaaaggggtggattcagaggaggccgtggaggtacccacaggggaggtttcccggca
cgctga

DBGET integrated database retrieval system