KEGG   Alligator mississippiensis (American alligator): 102561390Help
Entry
102561390         CDS       T03087                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00561  Glycerolipid metabolism
amj01100  Metabolic pathways
Module
amj_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102561390 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amj01002]
    102561390 (MGLL)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102561390 (MGLL)
Peptidases [BR:amj01002]
 Serine Peptidases
  Family S33
   102561390 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Lipase_3 Esterase DLH Abhydrolase_2 Peptidase_S9 PGAP1 Thioesterase Abhydrolase_5 LIDHydrolase DUF1350 DUF1057 Abhydrolase_3 TMEM117
Motif
Other DBs
NCBI-GeneID: 102561390
NCBI-ProteinID: XP_006264480
UniProt: A0A151MK56
Position
Un
AA seq 309 aa AA seqDB search
MGRPSRMPEESSPRRSPQHVPYQDLPHMVNADGQYLFCRYWKPAATPRALVFIAHGAGEH
CGRYDDLAQMLTGLNLFVFAHDHVGHGQSEGERMVVSDFHIFIRDSLQHIELMKKEHPDL
PIFILGHSMGGAISILTASERPNDFSGMVLISPLVVASPEAATPIKVFAAKVLNFVLPNL
SLGSIDPNVVSRNKKEVESYTSDPLVHHGGMKVSFVIQLMNAIARIERALPKLTLPILVL
HGSPDKLCDIKGSYLLMDTVLSQDKTLKVYDEAYHALHKELPEVSTAVFKEILTWIGQKV
AAAEESSHT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtccttccagaatgccagaggaaagttcccccagaaggagtcctcagcatgtc
ccttatcaggacctgccccacatggtcaatgcagacgggcagtacctcttctgcagatac
tggaaaccggcagcaaccccaagggccctcgtgtttatcgctcatggcgctggggaacac
tgcggccgctatgatgacttggcccagatgctgacaggacttaacttgtttgtatttgca
catgaccatgttggccatgggcagagcgaaggggagcgtatggttgtgtccgatttccac
attttcatcagagacagcttgcagcacattgaactcatgaagaaggaacaccctgatctg
cccattttcattctggggcattccatgggtggagccatctctattctaaccgcaagtgag
agaccaaatgacttttcgggcatggttttaatttctcctttggttgtagcaagccctgag
gcagcaacacccatcaaggtttttgcagcgaaagtgctcaactttgtcctaccaaacctg
tccctgggatccatagatccaaatgtggtttcccggaataagaaggaggttgaatcttac
acatccgatcccctggtccaccatggaggaatgaaagtctcctttgtcatccagctgatg
aatgccattgccagaatagaacgggccctccccaaattgaccctgccaatcttggtgctg
catggctcacccgacaagctctgtgacatcaaaggatcctatctgctgatggacacagta
ctgagccaggacaaaacactcaaggtgtatgatgaggcctatcatgctctccacaaagag
ctgcccgaggtcagcactgctgtctttaaagaaatactgacgtggatcggtcagaaggtc
gcagctgccgaagaatccagccacacttaa

DBGET integrated database retrieval system