KEGG   Alligator mississippiensis (American alligator): 102561422Help
Entry
102561422         CDS       T03087                                 

Gene name
SGMS2
Definition
(RefSeq) sphingomyelin synthase 2
  KO
K04714  shingomyelin synthase [EC:2.7.8.27]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00600  Sphingolipid metabolism
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102561422 (SGMS2)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.27  sphingomyelin synthase
     102561422 (SGMS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2_C PAP2 PAP2_3
Motif
Other DBs
NCBI-GeneID: 102561422
NCBI-ProteinID: XP_014451373
UniProt: A0A151MIX1
Position
Un
AA seq 365 aa AA seqDB search
MDSIETAKLEEHMEGQNNETSNGYARPTLSVSEESKNGNSKPKGLSNGLRKSTKKYPDYI
QISMPAESRNKFPLEWWKTGIAFVYALFNLILTTVMITVVHERVPPKELSPPLPDKFFDY
IDRVNWAFSVSEINGMILVGLWIIQWLFLRYKSIVGRRFFFIIGTLYLYRCITMYVTTLP
VPGMHFQCAPKLNGDSQAKVQRILRLISGGGLSITGSHILCGDFLFSGHTVVLTLTYLFI
KEYSPRHFWWYHLICWLMSAAGIICILVAHEHYTVDVIIAYYITTRLFWWYHSMANEKNL
KVSSQTNFLSRAWWYPIFYFFEKNVQGSVPCCFSWPISWPPSCFKSSCKKYSRVQKTGED
NEKST
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggatagcattgagacagcaaagcttgaagaacacatggaaggtcagaacaatgagacc
tcaaatggctatgctcgacctaccctatctgtcagcgaagagagcaaaaacggcaatagc
aaaccaaagggtttgtccaatggattgcggaaaagcacaaagaagtatccagactatatt
caaatttctatgcctgctgaatctaggaacaaatttcccttggaatggtggaaaacaggc
atcgcctttgtgtatgctctcttcaacttaattctaacgactgtcatgatcaccgtagtt
catgagagggtacctcccaaggagctcagccctcccttgcctgataagttttttgattat
attgatcgcgtgaattgggctttttctgtatcagaaataaatggaatgatactagttgga
ttatggataatccagtggctgtttcttcgatacaagtcaatagtgggacgcaggttcttt
tttataataggaacattgtacctgtaccgttgtattaccatgtacgttaccaccctacct
gtgcctgggatgcattttcaatgtgctccaaagttgaatggagattctcaagctaaggtg
cagaggatcctgcgactgatttctggtggtggtctgtccattacaggatcacacatccta
tgtggagattttctttttagtggtcacactgtagtgctaacactcacctacctatttatc
aaggaatattcacctcgtcatttctggtggtatcatttaatctgctggttaatgagtgct
gctggaataatctgtatccttgttgcacatgaacactacactgtggatgtcatcattgct
tattatatcaccacccggctcttctggtggtaccactcaatggccaatgaaaagaacttg
aaggtgtcttcccaaacaaattttctctctcgagcatggtggtatccaatattttatttc
tttgagaagaatgtacaaggttcagttccatgctgcttctcctggccaatatcttggcct
cccagctgtttcaaatcttcatgcaaaaaatattctcgggttcagaagacgggagaagac
aatgaaaaatccacttga

DBGET integrated database retrieval system