KEGG   Alligator mississippiensis (American alligator): 102561786
Entry
102561786         CDS       T03087                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102561786 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amj03000]
    102561786 (MECOM)
Transcription factors [BR:amj03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    102561786 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_11 zf-C2H2_8 SET PyrI_C
Other DBs
NCBI-GeneID: 102561786
NCBI-ProteinID: XP_019347242
Position
Un
AA seq 1213 aa
MPEPDGEATKLSLSVQEPSSPATSNEEFTPKESSPYKAPIYIPDDIPIPSEFELRESNIP
GAGLGIWTKRKIEVGEKFGPYVGEQRPALKNPSYGWEILDEFCNVKFCIDASQPDVGNWL
KYIKFAGCYNQHNLVACQTSDQIFYRVVADIEPGEELLLFMKSEDYSHDTMAPDIHEERQ
YRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVEEDFQKKLDNENDLQDMHEIQECKEC
DQVFPDLQSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKQV
FTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQ
FSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPG
TPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIP
ASSPVKGLPSTDQTNKSQSPLMTNPQILPATQDILKALNKQPSVGENKPVELQPERSSEE
RPHEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESDKEKFKENGKMFKDKVSSLQ
NLASINNKKEHNNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVG
ALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKMEPQSPSEIKKIPKGSSESPFDLTTK
RKEEKPVTPVATKPAAPPVTSQDQPLDLSMGSRSRASGTKQAEPRKNHVFGEKKGGELES
RKTSESSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQLPDQRT
WMSAIENMAEKLESFSALKPEASELIQSVPSMFNFRAPPSALPENLLRKGKERYTCRYCG
KIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCF
GQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTEIRNFIGNSNHSNQ
SPRNSEERMNGSHFKDEKAMGASQNSDLLDDEEAEDEVMMDEEDEESDIAAKAGKEPASS
TIHEGTPEDDYEETSTLDMNCKTSPGRYKDDEYNKTGLSALDHIRHFTDSLKMRKMEENQ
YNETELAAFNTPHLPEDLKQPLYRKSKSQAYAMMLSLSDKDSIHSASHNSPNVWHSMARA
AAEASAIQSISHV
NT seq 3642 nt   +upstreamnt  +downstreamnt
atgccagagcctgatggagaagcaactaagttgtccctcagtgtccaagagccatcttct
ccagcaacatctaatgaagaattcacaccgaaggagagctctccttacaaggctcctata
tacattccggatgacattcccattccatcagagtttgaactgcgagaatcaaacattcct
ggagcaggattagggatatggaccaaaaggaagattgaagtaggtgaaaaatttgggccg
tatgttggagagcagaggccggcccttaagaatcccagttatggttgggagatcttggat
gagttttgcaatgtgaagttctgcatagatgccagtcaaccagatgtagggaactggctc
aaatatatcaagtttgctggatgctacaatcagcacaaccttgttgcatgtcagacaagt
gatcagatattctacagagttgtagcagacattgaaccaggagaggagctgttactgttc
atgaagagtgaagattattcacatgacacaatggctcctgatattcatgaggagcgtcag
tatcgttgtgaggattgtgatcagctgtttgagtccaaggcagaactagtagaccatcag
aaattcccatgcagcacacctcactcagcgttttctatggtggaagaggactttcagaaa
aagcttgacaatgagaatgacctccaggacatgcatgaaatccaagaatgtaaagagtgt
gatcaagtgtttccagacttacaaagcctggagaaacacatgctgtcgcacagcgaggag
agggaatacaagtgtgaccagtgccccaaggcatttaactggaagtcaaacttgatacgt
catcagatgtcacatgacagtggaaagcactatgagtgtgaaaactgtgccaagcaggtt
ttcacggaccccagcaaccttcagaggcatattcgttcgcagcacgtgggggctcgtgct
cacgcttgtcccgaatgtggcaaaacgtttgctacttcttcaggcctcaaacagcataaa
cacatccacagcagtgtcaaaccctttatatgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgt
gaaggaaagaaccattttgcagcaggaggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgaatcatgcaaatccgggccttgct
gactattttggagccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttcaggcttgtaccacaggccacctttgatacct
gctagttctcctgttaaaggactaccaagcacagatcagacaaacaaaagtcaaagtccc
ctcatgacaaatcctcagatactgccagctacacaggatattttgaaggcactaaataag
caaccatctgtaggtgaaaataagccagtggagcttcaaccagagaggtcctctgaagag
aggccgcacgaaaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacc
cccagtggcagtgacttggagaccacctcgggctctgatctggagagtgacattgaaagt
gataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagctctcttcag
aatttggcttcaataaataataagaaagaacacaacaatcattccattttctcaccatct
ttagaggagcaaactgcggtttcaggagctgtgaatgattctataaaggctattgcttct
attgctgagaaatactttggttcaacaggacttgtggggctgcaagacaaaaaagttgga
gctttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatg
tatccatttcctgatagagacttgagaccattacctttgaaaatggaaccccaatcacca
agtgaaataaagaagatcccaaagggaagctctgagtctccctttgatctcaccactaaa
cgtaaggaggagaagcccgttactcctgtagcaaccaagccagcagctccacctgtgaca
agccaggaccagcctctagacctaagcatgggtagcagaagtcgagccagtggtacaaaa
caggctgaacctcggaaaaaccatgtgtttggtgaaaagaaaggaggtgaacttgaatca
aggaaaacatctgagtcctctttacaacatgccaggcccactccattctttatggatcct
atttacagagtagagaaaagaaagttaactgatccacttgaagctttaaaagaaaagtac
ttgagaccttcccctggattcttgtttcatccacaattccaattgcctgatcaaagaact
tggatgtcagctatcgaaaacatggccgaaaagctagagagttttagtgccctgaaacca
gaagccagtgaactcatacaatctgtcccgtccatgttcaacttcagagcccctccaagt
gccctcccagaaaaccttctcagaaagggcaaggaacgctatacctgcagatactgtggt
aagattttcccaagatctgcaaacctaacacgtcacctgaggacgcacactggagaacag
ccctacagatgcaaatactgtgacaggtcctttagcatatcttctaacctgcagaggcac
gtccgtaacatccacaataaggagaagccattcaaatgtcacttatgtgacaggtgtttt
ggtcaacaaaccaatctagacagacatctaaaaaagcatgagaatgggaacatgtctggt
actgcaacatcctcacctcactcagaactcgaaagcacaggggcaattctagatgacaaa
gaggattcttacttcacagaaattcggaatttcattgggaacagcaaccacagtaaccaa
tcccctagaaattcagaagagagaatgaatggcagccacttcaaggatgagaaagccatg
ggggcgagtcagaactccgacttgttggatgatgaagaggcagaagatgaagtaatgatg
gatgaagaggatgaagaaagtgatattgcagcgaaggcgggcaaagaacctgcttcaagt
accatacatgaaggaacccctgaggatgactatgaggaaacaagtactttggatatgaat
tgcaagacttcccctggcaggtataaagacgatgagtataataagactggactatcagct
ttggaccacataaggcacttcacagatagcctcaaaatgaggaaaatggaagaaaaccag
tacaatgaaactgaactggcagcctttaatactccccacctgccagaggacctaaagcaa
ccactgtacaggaaatcgaagtcccaggcatacgctatgatgctctctctctctgacaag
gactccatccattctgcatcccataattctcccaacgtgtggcacagtatggcaagagct
gccgcagaagccagcgccatccaatccattagtcacgtatga

DBGET integrated database retrieval system