KEGG   Alligator mississippiensis (American alligator): 102562163Help
Entry
102562163         CDS       T03087                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04060  Cytokine-cytokine receptor interaction
amj04068  FoxO signaling pathway
amj04110  Cell cycle
amj04218  Cellular senescence
amj04350  TGF-beta signaling pathway
amj04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102562163 (TGFB2)
   04350 TGF-beta signaling pathway
    102562163 (TGFB2)
   04068 FoxO signaling pathway
    102562163 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102562163 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102562163 (TGFB2)
   04218 Cellular senescence
    102562163 (TGFB2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102562163 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amj04052]
    102562163 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:amj00536]
    102562163 (TGFB2)
Cytokines and growth factors [BR:amj04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102562163 (TGFB2)
Glycosaminoglycan binding proteins [BR:amj00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102562163 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 102562163
NCBI-ProteinID: XP_006265110
UniProt: A0A151P3E4
Position
Un
AA seq 413 aa AA seqDB search
MHCYLLSVLLSLDLAAVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPDEYPEP
EEVPPEVISIYNSTRDLLQEKANHRAATCERERSEEEYYAKEVYKIDMLPFYPENAIPPS
YYSLYYRIVRFDVSAMEKNASNLVKAEFRVFRLQNSKARVSEQRIELYQVVKSKELPSPG
QRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHRDRNLGFKISLHCPCCTFVPSNNYIIPN
KSEELEARFAGIDDSYTYSSGDVKALKSNKKKYSGKTPHLLLMLLPSYRLESQQPSRRKK
RALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYHANFCAGACPYLWSSDTQHS
RVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctacctcctgagcgtgctcctcagcctggacctggcggcagtggcgctgagc
ctgtcgacctgcagcaccctcgacatggatcagttcatgcgcaagcggatcgaggcgatc
cggggccagatcctgagcaagctgaagctcaccagccccccggacgagtaccccgagccc
gaggaggtgccgccggaggtcatctccatctacaacagcacccgggacctgctgcaggag
aaagccaaccaccgagccgccacttgcgagcgggagcgcagcgaggaggagtattatgcc
aaagaggtttacaaaattgacatgctgccgttttaccccgaaaatgccatcccaccaagc
tattacagcctttactacagaattgtaagatttgatgtctcagcgatggagaaaaatgct
tccaacttggtgaaggcagagtttagagtcttccgtttgcagaattcaaaggcacgggta
tctgagcaacgaatagaactgtatcaggttgttaaatccaaagaattaccatcaccagga
cagcgctacattgatagcaaggtagttaaaacaagagctgaaggggaatggctatctttt
gatgtcactgatgctgtacacgaatggctccatcacagagacaggaatcttggatttaag
ataagtttacactgtccatgctgcacctttgtgccttcaaataattatatcatcccaaat
aaaagtgaagagcttgaagcaagatttgcaggtattgatgactcctacacatattccagt
ggtgatgtgaaagctttaaagtccaataagaaaaaatacagtgggaagaccccacatctt
ctgctaatgttattaccctcctacagacttgagtcgcaacagcccagtcggcggaagaag
cgtgctttagatgctgcctattgttttagaaatgtgcaggataattgctgcttgcgtcca
ctttatattgacttcaagagggatcttggctggaaatggattcatgaacccaaagggtat
catgctaatttctgtgcaggagcctgcccatatttatggagctctgatactcagcacagc
agagtactgagtttatataatacgataaatccagaagcctctgcctctccatgctgtgta
tcccaagatttggaacccctcaccatcctgtactacattggcaaaacacctaaaattgaa
cagctttccaacatgattgtgaagtcatgcaaatgcagctag

DBGET integrated database retrieval system