KEGG   Alligator mississippiensis (American alligator): 102563459
Entry
102563459         CDS       T03087                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:amj03021]
    102563459 (AFF3)
Transcription machinery [BR:amj03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102563459 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 102563459
NCBI-ProteinID: XP_019340616
UniProt: A0A151NX18
Position
Un
AA seq 1253 aa
MDSFDLALLQDWDLDSLCVYEPDRNVLRKKEWERRNQETQQEDGTFNTSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDLLTDRSNQSHLVGVPKPGIPQASVAKADEHFITDSRPQS
QPSISSSSSIPAALCGQNKSTTMGWQKVGQNASDGQQRTSKHGHRLLESHNSDFKMTNQK
SSLEKLKHYASSPTSSASNATQPGTLRSTLGDSVSRVQQQSKISCNAEVGPQAQERPTKH
TTGHCVQNFPPSLASKPTIVQQKPTAYVRPMDGQDQAPDESPKLKLSAETNKHCTSYRGV
PSNKPDSTRTKSKITKFSIPKQEEDSGTGDNSCIEEILQEMTHSWPPPLSAIHTPGKVEQ
SKFSFPNKESQQGSTGPSNTRKSDVEPKSPENSASHTSMLLQASLLLFDLLNWRLPSGML
EDDLKLSSDEEENDQQAAQRSTLRVLSDSTGVQQPNSRTSGLSSKGSSSSSSSESESSSE
SDSESESSSSESDGSKPSHYSSPEPEQPSSNKWQLDKWLNKVNPHKTPILSQNDNHGLES
NQYYSRIKEEGQECEKLPDICQTDLRDKEIKNASKEELRPRTANKAPGNKGGKQKSPLAA
VAAASGDSGPQRKPICKKQPRRTERTSGGDALNCHTSEDLTLSQGFLENNICEQPKARPC
SNRTGHRKEPRSVTTCEKRRTRGPSKTAPKSREFIETESSSSSSSSDSDSESEQEDYSLP
KPQTVASASAGNDQRLKDSGSSNSNKTNSSCSAFGSINARTSNEIAKELEEQFYTLVPFG
RNELLSPLKDSDEVKSLWVKIDLTLLSRIPERSPEEPLAMSTGAKEVASIHQNNSIDPPA
EKVLPKSRRKRKCENEEEHRESKKPHLERECSSRLIASAQSISTTNHCNINENSLAIPIN
KNEKMLRSPISPLSDASKHKYSSNDLTSSSRPNGSSLLPSISSSKKHKGEIQSQQHPGDF
NKAIHINSENVLCNKPQFQTEPWSPLSNAPRDCRRTKLVFDDMPRNADYFMQEAKRKKHK
ADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAVRLKTHSG
PNATPEDKQLAALCFRCLALLYWRMFRLKRDHAVKYSKALIEYFKNSSKAAQAPSPWGAS
GKSTGTPSPMSPSPSPVSSVGSQGSTGTPSPSSIISIPQRIHQMAANHVSITNSILHSYD
YWEMADNLAKENRDFFNDLDALMGPVTLHSSMEHLVQYTQQGLHWVRNSAHLS
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttggcgctgctgcaggactgggacctggactcgctgtgtgtctat
gaaccagacagaaatgtgctgcggaagaaagaatgggaaaggagaaatcaggaaacacag
caggaagatggcacatttaacacaagttactccctcttcagtgaaccatacaagactaac
aagggggatgagctctcaaatcgcatccagaatacattaggcaactatgatgaaatgaaa
gatttactgactgatcgatccaaccagagccaccttgttggggttccaaaaccagggatc
ccacaggcatctgtagctaaagcagatgaacatttcattacagactcaagaccacagtcc
cagccttccatcagcagttcatcctccataccagcagcattatgtggacagaacaagagc
accacaatgggttggcaaaaagttgggcaaaatgcttctgatggccagcagaggacaagc
aagcatggccacagattacttgaatcacacaacagtgacttcaaaatgactaaccaaaaa
tccagtctagaaaagctaaaacactatgcatcaagtccaacatcctctgcctccaatgct
acacaaccaggtactttaagatccacacttggagacagtgtcagcagagtgcaacagcag
tcaaaaataagttgcaatgcagaagttggacctcaggctcaagaaaggccaacaaaacat
accactgggcattgtgttcaaaactttcctccttcacttgcttcaaagcccactatagtg
cagcagaaaccaacagcttatgtaaggccaatggatggacaagatcaggctcctgatgaa
tccccaaagctaaaattatctgcagaaactaacaagcactgtacatcatataggggagtt
ccttctaataaacctgactcaactagaaccaagtctaagattacaaaatttagcattccc
aagcaagaagaggacagtggaacaggagataacagctgcattgaagaaattttacaggag
atgacccattcttggccaccaccactctcagctattcacacgcctggaaaagtagaacag
agcaagttttcattcccaaacaaggagtcacaacagggatcaacaggacccagcaataca
aggaaaagtgatgttgagccaaagagtccagaaaatagtgcatctcatacatcgatgtta
ttacaagcaagtttactgctctttgatttgctgaactggagactgccttcaggaatgcta
gaagatgacctcaagttaagtagtgatgaagaagagaatgatcagcaggcagcacagaga
tctactctccgcgttctatctgacagcactggcgtgcaacagcccaatagcagaacctca
ggactctccagcaaggggtcaagcagcagcagctccagtgaatccgagagcagttcagag
tctgattcagagagtgaaagcagttctagtgagagtgacggcagcaagccctctcattac
tccagcccagagcctgaacaaccatcatcaaacaagtggcaactggataaatggctaaat
aaagttaatcctcacaaaacgcctattcttagccaaaatgataaccatggactggagagt
aatcagtattacagcaggataaaggaggaaggacaggagtgtgagaaattaccagatatt
tgccaaacagacctcagagacaaagaaattaagaatgccagcaaagaggagctgaggcct
agaactgctaataaagcaccaggcaataaaggagggaagcagaaatcacctctcgctgct
gttgctgctgcttctggagacagcggccctcagagaaagccaatctgtaaaaaacagcca
agaaggacagagaggacctctggtggagatgctttgaactgccatacatctgaggatctc
accctgagccaaggatttttagaaaataacatctgtgagcaacctaaagccaggccctgc
agcaacagaactgggcacaggaaagagccccgctctgtcactacatgcgaaaagagacgt
acccgggggccaagcaaaacagcacctaaatccagggaatttatcgagacagagtcttca
tcatcctcctcttcctccgattcagattcagaatccgaacaagaggactattctctccct
aaacctcagactgtggcctctgcttcagctggaaatgaccagaggttgaaggactctggg
agcagtaactccaacaaaaccaacagcagctgcagtgcctttggctccattaatgccagg
actagtaatgaaatagcaaaggagctggaggaacaattttacaccctggttccttttggt
aggaatgagctcctgtctcctctgaaagacagcgatgaggtaaaatcactgtgggtcaaa
attgatttgactcttttgtccaggattccagagcgttcacctgaggagccattggcaatg
agcactggagcaaaagaagtagccagcattcaccagaataacagtattgacccaccagcg
gaaaaggttttaccaaaatctagaaggaaacgcaagtgtgaaaatgaagaggagcacagg
gagagcaagaagcctcatttagagcgagagtgttcttcacgattaattgcctctgcccaa
agtatttcaacaacaaatcattgcaacataaatgaaaatagcttggcaataccaataaat
aaaaatgagaaaatgcttcggtcacccatctcacccctctcggatgcatcaaaacacaaa
tactccagcaatgatttaacttcttccagtagacctaatggcagcagtctgttaccttcc
atctcctccagcaaaaaacataagggtgaaatccagtcacagcaacatcctggagatttc
aataaagcaattcatatcaattcagaaaatgttctctgcaataagccacagttccaaaca
gagccatggtcacctttatccaatgcaccgagggactgcagaagaacaaagcttgtcttc
gatgatatgccacgcaatgcagattactttatgcaagaagctaaacggaagaaacataaa
gcagatgcaatggtggagaaatttggaaaggcacttaattatgctgaagcagcattgtca
tttattgaatgtggaaatgctatggaacaaggccccatggaatctaaatccccttataca
atgtactcagaaacagttgaacttatcaggtatgctgtgagactaaaaacccactcaggc
cctaacgccactccggaggacaaacagctcgcagcattatgtttccgctgcttggccctt
ctgtactggagaatgttccgactcaaaagagaccatgctgtaaagtattcaaaagcactt
attgaatatttcaagaattcatcaaaagctgcacaggccccatccccctggggtgccagt
ggaaagagcacaggaactccatcccccatgtccccaagtccttctccagtcagctctgta
ggatcccaggggagcaccggtaccccttccccttcctccatcatcagcattccccagcgt
attcatcagatggctgccaatcatgtcagcatcaccaacagcatcttgcacagttatgac
tactgggagatggctgacaatctggccaaggaaaacagagatttttttaatgacttggat
gcattgatgggacctgtcaccttgcacagcagtatggagcatttagttcagtatactcaa
caaggacttcactgggtgcggaatagtgctcacttgtcataa

DBGET integrated database retrieval system